KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g197800Help
Entry
NEMVE_v1g197800   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00010  Glycolysis / Gluconeogenesis
nve00562  Inositol phosphate metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NEMVE_v1g197800
   00562 Inositol phosphate metabolism
    NEMVE_v1g197800
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     NEMVE_v1g197800
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     NEMVE_v1g197800
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 5520830
NCBI-ProteinID: XP_001640538
JGI: 197800
UniProt: A7RIX6
AA seq 448 aa AA seqDB search
MLAVSTLILVLSFVLLSQGEGHYRNFASKTRYYEPNLEEDIKKEREGGCSAVHMSLVARH
GTRNPSKRDVKKIQRTTEAIDQLFSGHPVKIGNLTIPSPSLFTENMDKDLIEIGREELYN
MSRRVKQRYPELFNVEMLKEKIRFVSTRTARSIQSAHAFALGLLGRPLVPIAMVTDIDKD
PITIETHDKDNDPVLRYFDVCPKYIHQVSKNKTSLYEHHEFKNSSAMRTVVEHVRDLFNL
QGSEIIHVKHVIGMYLACTFEVAVYNRSDSWCSVFRPSDLDVLEYFYDLKHYWKRGYGYK
ITYEISCVLLKNIINTIKTAVLSDNKNGPIGNFMFAHAETIQPLNALLGLFKDVMPLRAD
NYHRHKNRKYRASQISPFGANIAFTVYNCSGLYQIQVLSNEKIVSLPCCEGPRCPLQRFF
DCFSEVYNMCDLKALCELDKKAQVREDL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgcttgcggtatctacattgattcttgtgctgtcttttgtactcttgtcacagggggaa
gggcactatcggaatttcgcctcgaagacgcgttactacgagccaaatcttgaggaagac
atcaagaaggaaagggaggggggctgttctgccgttcacatgagcttggtcgcgcgacat
gggacgcggaatccgagcaaaagagatgtgaaaaagatccagcgtacgactgaagcaata
gatcagctatttagtgggcaccctgtgaaaattggtaatctcacaattccttccccgagt
ttatttacagaaaatatggataaggacttgattgaaataggaagggaggaactttataac
atgtcacgacgcgttaagcagagatatcctgaattatttaatgtagaaatgttaaaagag
aaaattcgcttcgtcagcaccagaacggctaggagcattcaaagtgcacatgcatttgca
cttggtcttcttggtagacctcttgtgccaattgctatggtaacagacattgacaaggat
cctattaccatagagacccacgataaagacaatgatccagtgctaaggtatttcgatgtg
tgtcccaagtacatccatcaagtgtccaagaacaagacttccctgtatgaacatcatgaa
tttaaaaacagctctgcaatgagaaccgttgtggagcatgtcagagacttgtttaatctt
caagggtctgagatcatacatgtcaagcatgtgatcggcatgtatcttgcctgtactttt
gaggtggctgtctataacagatctgattcctggtgttcagtgttccgtccaagtgacttg
gatgtgctggagtatttctatgatctaaagcattactggaagagaggctatggatacaag
atcacttatgaaattagctgtgtgttattaaaaaatattatcaatacaatcaaaacagca
gtcttgtctgacaacaaaaatggccctattggtaattttatgtttgctcatgcggaaacc
atacagccattaaatgctctgctaggtctctttaaagatgtaatgcctttgagagcagac
aattaccacagacacaagaaccgcaaatatagagcaagccaaatctcaccgtttggggcc
aatattgcatttactgtgtataactgttctggactgtaccagattcaagttctttccaat
gagaaaattgtctctttgccctgctgtgagggccctagatgtcctttgcagaggttcttt
gactgttttagtgaggtctacaatatgtgtgaccttaaagccctgtgtgaattagataaa
aaggctcaagttcgtgaggatttataa

DBGET integrated database retrieval system