KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g201226Help
Entry
NEMVE_v1g201226   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01229  lactase-phlorizin hydrolase [EC:3.2.1.108 3.2.1.62]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00052  Galactose metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    NEMVE_v1g201226
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nve03110]
    NEMVE_v1g201226
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.62  glycosylceramidase
     NEMVE_v1g201226
    3.2.1.108  lactase
     NEMVE_v1g201226
Chaperones and folding catalysts [BR:nve03110]
 Intramolecular chaperones
  Others
   NEMVE_v1g201226
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-GeneID: 5517918
NCBI-ProteinID: XP_001637902
JGI: 201226
UniProt: A7RRX8
AA seq 485 aa AA seqDB search
MDCFAEEGDFMKGQFPESFIWGVATAAHQIEGAWNEDGKGPNIWDAFSHKTGNIHNNENA
DIACDSYHKTDEDIQLLKSLGVSHYRFSISWARILPDGLLDVVNKSGVEYYNRVIDKLLA
VNIQPVATLYHFDLPQALQDKGGWLNSRVIEWFAGYARVCFKLFGDRVRLWLTINEPHEE
ALNGYGYGNFAPGIKRLDTAPYQVVHNMLRAHASAWHIYDEEFRGSQHGKLSIVTNSQFY
EPKSTKPYDVAAADRGLQWYLGWIAHPVVYGDYPEVMKQVVAEKSKKQGIPCRLPSFTAE
EKTYIKGTIDFFALNFYSASLTEHIDIPMNSNENWNYITDQEIKTSRREHWIKGAPDWLY
CTPFGLRKILNWIKGNYNNPEIIITENGFSCDGEEDLSGDAALEDTHRVNYLKGYLNQAL
KSVIKDGVQLTGYFLWSLMDNFEWDDGYKFRFGVHHVDFDDPHKHRTPKKSALVFKEIVA
NKGFI
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atggactgtttcgccgaagagggtgacttcatgaaaggccaatttcccgaaagttttatt
tggggagtcgccactgccgctcatcaaatcgaaggtgcgtggaacgaggatggaaaaggg
cctaacatctgggacgccttctcacataagactggcaacatccacaacaatgagaacgcc
gacatcgcatgtgacagctaccataaaacagacgaagacattcagcttttgaaatcactc
ggagtgagtcattataggttttctatctcgtgggcacgtatccttcccgatggactccta
gatgtcgtaaataaaagcggcgtggaatactacaatcgtgttattgataagcttttagcg
gtgaatatccaaccggttgcgacactctaccattttgacctgccacaggcccttcaggat
aaaggaggctggctaaactcgcgggtcattgagtggtttgcaggatatgcgcgtgtctgc
ttcaagttgtttggggacagggtcagactgtggcttactatcaatgagccccatgaggaa
gcactgaatggatacggatatgggaactttgcaccgggaatcaagagacttgatacagcg
ccataccaagtggtccataatatgctaagggcacatgcgtctgcttggcatatctatgat
gaggagttccgtggcagccagcatggcaagctgagcattgtgacaaacagtcagttctat
gaacccaagtccacaaagccttacgatgtagccgctgcagacagagggttacaatggtat
cttggatggattgctcatcctgttgtctatggagactaccctgaagtgatgaaacaggtt
gttgcagagaaaagcaaaaagcaagggattccttgcagattaccatccttcactgctgaa
gaaaagacatacatcaagggaacaattgatttttttgcactcaacttttactctgcatca
cttacagaacacattgatattcccatgaattccaatgagaactggaactatataacagac
caagaaattaaaacatctagacgagagcactggattaaaggtgcacctgattggctgtat
tgcacgccatttggacttcgcaaaatcctcaactggataaagggaaattacaataaccca
gaaatcataatcacagagaatggctttagctgtgatggggaagaagacctgagtggagat
gctgctctggaggacacccaccgagtgaattaccttaagggctacctaaaccaggcttta
aagtcagtcattaaagatggggtacaattaacaggctactttttgtggtctttgatggat
aattttgagtgggatgatggttataagtttcgtttcggggttcatcatgtggattttgat
gacccacataagcatcgcactcctaagaaatcagcccttgtgttcaaagaaattgtagct
aacaaaggatttatatga

DBGET integrated database retrieval system