KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g207834Help
Entry
NEMVE_v1g207834   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nve01001]
    NEMVE_v1g207834
Enzymes [BR:nve01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     NEMVE_v1g207834
Protein kinases [BR:nve01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   NEMVE_v1g207834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like Choline_kinase
Motif
Other DBs
NCBI-GeneID: 5512145
NCBI-ProteinID: XP_001632484
JGI: 207834
UniProt: A7S729
AA seq 348 aa AA seqDB search
MKPLFKIPPALQPKKTLITNDYNITQKVLGVGINGKVLECFDKKTNDKHALKVLHDNLKA
RREVELHWKSSLCPYIVGIKDVYENKYAKNDCLLVVMECMSGGELFERIQRRGDNPFTER
EAASVVRQVTTALAHLHSLNIAHRDLKPENLLYANHSENAALKLTDFGFAKETDAALTLQ
TPCYTPYYVAPEVLGPERYDKSCDMWSLGVIMYILLCGFPPFYSNHGAAISPGMKKRIRQ
GQYDFPNPEWSYVSQQAKDLIRGLLRTDPTKRFTVEEVMNNPWIKAYTEVPSTPLHTAAV
LKEEEENWQDVQDEMTNALATMRVEYDKVTKLKDVSQSSNPLLNRRKR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaacctttattcaagattccgccggccttacaaccgaagaaaacgcttataaccaac
gactacaatataacacagaaagttcttggtgttggcataaacggaaaagttctggagtgt
ttcgataagaaaaccaacgataaacacgcgctaaaggtgctacatgacaatttaaaagca
cgtcgtgaagtggagttgcactggaagtcttccttgtgtccatatatagttggcattaaa
gatgtatatgagaataaatatgccaagaatgactgcctcttggttgtcatggaatgtatg
tctggaggggagctatttgaaagaatacaaaggagaggagacaatcctttcacagaaaga
gaagctgcctctgttgtcagacaagttaccacagcactagcacaccttcattcactaaac
atcgctcacagagatctcaagccagagaacttactctatgctaaccactctgagaatgct
gcattgaagctgacagactttggatttgccaaagaaaccgatgctgcacttaccttgcag
acaccctgttataccccatactatgttgctcctgaggtgttgggccctgagcgatatgat
aagtcatgtgacatgtggtcattaggagtaattatgtatattctgttatgtggattccca
ccattctacagtaatcatggagctgccatctcgcctggcatgaaaaagagaatacgacag
ggtcaatatgacttccctaatccagagtggagttatgtgtcacagcaagccaaagatcta
atcaggggattgttgaggacagatccaactaaacggttcacagtagaagaagtcatgaac
aacccgtggattaaggcttacactgaagtgccctcaacacccctacacacggccgctgtg
cttaaggaggaggaagagaattggcaagatgtgcaggacgagatgacgaacgctttagcc
acaatgcgggtggaatacgacaaagtcacgaagctgaaggacgtgagccagtcgtcaaac
cctctcctgaacaggcgcaagaggtag

DBGET integrated database retrieval system