KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g220734Help
Entry
NEMVE_v1g220734   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00214  biliverdin reductase [EC:1.3.1.24]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00860  Porphyrin and chlorophyll metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NEMVE_v1g220734
Enzymes [BR:nve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.24  biliverdin reductase
     NEMVE_v1g220734
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Biliv-reduc_cat
Motif
Other DBs
NCBI-GeneID: 5501074
NCBI-ProteinID: XP_001622418
JGI: 220734
UniProt: A7T143
AA seq 232 aa AA seqDB search
AWEELAEPECAISPRKTLEIPNWSALYHGLILQEEDIGLHLPQQKELRETLKSKPRVTKA
KMTFSATFSNQWIGDLTRAGFPSFSGLSRIHIVYTLFGEVTVSKASLLREENRICITATL
LTKDKRPIEWTEDRGEGFQRSFGMDFELEDGSKFHYPPSTPSPSHGAPSGPSPHGEGGDA
KSGPPKGLFAADLLLFLSKLRGEVKEEEMAEEKARVLHCLEVAGEIERLATL
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
gcttgggaagagctggcagagcccgagtgcgcgatctcaccgagaaagactttggaaata
ccaaactggtcggcgttgtatcacgggcttatcctccaggaggaagatatcggcttacac
ctccctcaacagaaggagctcagggagactctcaaatccaaacctcgagtcacaaaggcg
aagatgacattctcagcaacatttagcaatcaatggatcggcgacctcacacgcgcggga
ttcccgagtttctcgggactgtctcgcattcacattgtgtacactttgttcggagaggtt
accgtcagtaaggctagtctgttgcgagaggagaaccgcatctgtataaccgcaactctc
ctgactaaggataaaagacccatagagtggacggaggatcgtggcgaaggtttccagcgc
tcatttggtatggatttcgagctagaagatgggtccaagttccactacccgccaagcacc
ccatcaccctctcacggggctccctctggtccctccccacacggggagggaggagacgca
aagagtggaccccctaagggactctttgcagctgatttgcttttatttttaagcaaactg
cgcggtgaagtaaaagaggaagaaatggcggaggaaaaagctagagttcttcattgtctt
gaagtagcaggagaaattgagaggctagccactttgtag

DBGET integrated database retrieval system