KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g229400Help
Entry
NEMVE_v1g229400   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
nve  Nematostella vectensis (sea anemone)
Brite
Chromosome and associated proteins [BR:nve03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    NEMVE_v1g229400
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g229400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF CENP-T_C TAF TFIID_20kDa CENP-S TFIID-31kDa CaiF_GrlA
Motif
Other DBs
NCBI-GeneID: 5513031
NCBI-ProteinID: XP_001633339
JGI: 229400
UniProt: A7S4X9
AA seq 213 aa AA seqDB search
MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLK
VFLENVIRDAVTYTEHAKRKTVTAMDVQTRKMPPKPVGKSAGKKAVKKQVGEGKKKRKGR
RKESYAIYIYKVLKQVHPDTGISSKAMGIMNCFVNDIFERIAGEASRLAHYNKKSTITSR
EIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcgcggcaaaggaggaaaaggtctaggaaagggaggcgcgaagcgtcatcgt
aagatccttcgggacaacatccagggcatcaccaagcccgccattcgacgtctcgctcgc
cgtggtggagtcaagcgaatctctggcctcatctacgaggagacccgtggcgttctcaaa
gtcttccttgagaacgttatccgtgacgcggttacctacaccgagcacgccaagcgcaag
actgtcaccgccatggacgtgcaaaccagaaaaatgccgccaaaaccagttggaaaatcc
gcaggcaagaaggccgtcaagaagcaggtcggagaaggaaagaagaagagaaagggaaga
cgtaaggaaagctatgctatctacatctacaaggtgctgaagcaagtccaccccgacacc
ggtatctcgagcaaggccatgggcatcatgaactgtttcgtgaacgacatcttcgagcgc
atcgctggtgaagcttcccgcctggcgcactacaacaagaagtccaccatcacgagcagg
gaaatccagacggccgttcgtctgctcctccccggtgagctggccaaacacgccgtgagc
gagggaaccaaggcagtcaccaagtacaccagcagcaagtaa

DBGET integrated database retrieval system