KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g234959Help
Entry
NEMVE_v1g234959   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K15259  poly [ADP-ribose] polymerase 7/11/12/13 [EC:2.4.2.30]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NEMVE_v1g234959
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     NEMVE_v1g234959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP WWE
Motif
Other DBs
NCBI-GeneID: 5512770
NCBI-ProteinID: XP_001633051
JGI: 234959
UniProt: A7S5J9
AA seq 309 aa AA seqDB search
MDENGKWQSYDSPESGKAPSTTCSKALEKGFLAGEGTHDFSAGMFKYTLHFDKLYQKNNT
TGNKRPVRRIPEFVAENDMKEIAKRRKAAAAAAAAASEPSSGGPSSTVLPKHWDPIPDDK
DFICVQLSSTSPEYKKIEAQFLSSLDTSRRIVKIERIQNPDLWMQFAQKKERMEKKSKCI
PEERSLFHGTASDIVTAICQQGFDWRLCGKHGTVYGQGSYFASTAAYSHRYSSSNSLYSN
RASQQMFVAKVLVGSYTVGSSSYTRPPAKDPAKPHGELYDSCVNDEQNPGIFVVFDNSQV
YPEFLISYL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggatgagaatggcaaatggcagtcatatgacagtccagaaagtggcaaggcacccagc
accacatgcagcaaggctctagagaagggttttctggcaggtgaaggtacccatgacttt
agtgctggaatgttcaaatatactttgcactttgataaattgtatcaaaagaacaacaca
acaggaaataagagaccagttagacgtataccagaatttgttgcagagaatgacatgaag
gaaattgctaaaagacgcaaagctgctgctgctgctgctgctgctgcctctgaaccttca
tctgggggacctagttccactgtcctaccaaagcactgggaccccataccagatgataag
gacttcatctgtgtacaactttcatcaacctctccagaatacaagaagattgaggcacaa
tttttaagcagcttggacaccagtaggagaattgtcaagatagagagaatccagaacccg
gatttgtggatgcagtttgctcaaaaaaaagaacgcatggagaagaagtcaaaatgcatt
ccagaagaacgctccctgttccatggcacagcaagtgatattgtgactgccatatgccag
cagggcttcgactggcgcctttgtggcaaacatggcactgtgtatggtcaaggaagctac
ttcgcctctactgcggcttactcacatcgctacagcagtagtaattccctttatagcaat
agagcatctcaacagatgtttgtggcaaaagtccttgttggctcatacactgttggaagc
tcaagctatacccgccctccagccaaagatccggccaaacctcatggcgaattatacgac
tcatgcgtaaacgacgagcaaaacccaggcatttttgtagtttttgacaacagccaagtc
tacccagagttcctcatttcatacctgtag

DBGET integrated database retrieval system