KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g237233Help
Entry
NEMVE_v1g237233   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K17264  endoplasmic reticulum resident protein 44
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nve04131]
    NEMVE_v1g237233
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nve04147]
    NEMVE_v1g237233
Membrane trafficking [BR:nve04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    NEMVE_v1g237233
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   NEMVE_v1g237233
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin_6 Thioredoxin Thioredoxin_2 Calsequestrin Thioredoxin_7 ERp29_N
Motif
Other DBs
NCBI-GeneID: 5508790
NCBI-ProteinID: XP_001629332
JGI: 237233
UniProt: A7SG87
AA seq 428 aa AA seqDB search
MASFSNSWLLLVFTIFYYFSPTICSNVVILDEGNFDKVIAENKLVFVNFYADWCRFSQML
SPIFDQTSDIAKEEFPSDLVLAKVDCDSHPEVGQRFQITKYPTLKLWRNGQPARREYRGQ
RSVDAFSNYLRNQMRSSIKEFHSLSDMGLNSKKRNIIAYLESKEGDNYKKFEKLAEEFRE
DCEFHVGVGDSSAKERKVGDNLVYRPENKGPEGDIVYTGSLTDFEHLKQWTNDKCIPLVR
EITFENAEELTEEGKPFLLLFYDPNDHHSIEEFKEEVAKQLVGEKGQMNFLIADGHKFSH
PLHHLGKSQQDLPLIAIDSFRHMYLFPKFEDIRIPGRLKQFTDDLHSGKLHREFHHGPDP
TPDTHAAPGEPRVPHGDTGDSTEPKPDAGTQPQGSSGDKRKTKTSPPETIFKKLSPSYNR
YTLLRDEL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcttctttctcaaactcttggcttcttttagtttttacgatattttattatttcagt
cctacaatatgcagcaatgtagtgatattagatgaaggaaacttcgataaagtaatcgct
gaaaacaagttagtcttcgttaatttttacgccgactggtgtcgatttagtcaaatgctg
tcacccattttcgaccaaacatcagatatagcaaaagaagaattcccaagtgacctagtg
cttgcaaaagtagactgtgacagccatcctgaggttgggcaaagattccagataaccaaa
tacccaactttaaagctgtggaggaatggacagcctgccaggcgtgaatacaggggacag
aggtctgttgatgccttttcaaactacttgaggaaccagatgagaagcagtatcaaggaa
tttcactcacttagcgatatggggctaaattcaaagaaaagaaacatcattgcatatttg
gagagtaaagaaggggacaattacaaaaaatttgagaagcttgcagaggaatttagagag
gattgtgaattccatgttggagtaggggattcatctgctaaggagaggaaagttggagat
aaccttgtatatagaccagaaaataagggaccagagggtgatattgtttacacaggaagc
ctgacagactttgagcatttgaagcagtggacaaatgacaaatgtatcccactggtgcgg
gagatcacttttgagaatgcagaagagctgacagaggagggaaaacccttcttactcttg
ttctatgaccctaatgaccaccatagtattgaggaattcaaagaggaagtcgccaagcag
cttgttggcgaaaaaggtcaaatgaacttccttattgctgatggacacaaattctcccat
cccctccatcaccttggcaagtcccaacaggacctacccctcattgccattgacagcttc
agacatatgtatctctttccaaagtttgaagacataagaatacctggacgactgaagcaa
tttaccgatgatcttcactctggaaagcttcaccgagaatttcatcatggtcctgaccca
acacctgacacccatgcagcccctggcgagcctcgtgtgcctcatggtgacactggcgac
tccactgaaccgaaacctgacgcaggcacacagcctcaaggcagctcaggagacaaaaga
aagaccaaaacatcacccccagaaacaatctttaaaaagctctctccaagttacaaccgt
tatacccttctacgagatgagctataa

DBGET integrated database retrieval system