KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g239368Help
Entry
NEMVE_v1g239368   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nve00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    NEMVE_v1g239368
Enzymes [BR:nve01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NEMVE_v1g239368
Chaperones and folding catalysts [BR:nve03110]
 Protein folding catalysts
  Protein disulfide isomerase
   NEMVE_v1g239368
Membrane trafficking [BR:nve04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    NEMVE_v1g239368
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin ERp29 OST3_OST6 Thioredoxin_2 Thioredoxin_8 AhpC-TSA Thioredoxin_7 ERp29_N TraF HyaE DUF5484
Motif
Other DBs
NCBI-GeneID: 5519441
NCBI-ProteinID: XP_001639403
JGI: 239368
UniProt: A7RMG9
AA seq 363 aa AA seqDB search
MASGTVLFKLFLLFSISSLTQGKVIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPT
YEQLGEAYTQSSDVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDIND
FIKFIEEKTGVRGRVPVIPSAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVY
EKVGEAFKNEPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSF
VDFMNEKCGTKRTPGGGLNEQAGRINAFDGFAVEFMKNKDGRDNVYNNAKSAVDKQDDQK
MATYYVKVMERVQSKGDSFIQTETSRLERLLEGQISAGKKDQFIMRKNVLSQFAKGMESK
EEL
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccggcactgttctcttcaaactcttccttcttttctcgatttcctcgttaacc
caaggaaaagtgattgatctcaccaaggataattttgatgaggtagttaatggagaaaag
tttgctcttgttgaattctatgccccatggtgtggtcactgcaagcagctcgcccctacc
tatgaacagcttggtgaagcctatacccagtcaagtgacgtcataattgccaaggtggat
gctgatggggatcgggacttagggtcaagatttgatgttaaaggatttcctaccatcaag
tattttcctaaaggaagcaccactccagaagaatacaatggtgggcgtgacatcaatgac
tttataaaatttattgaagaaaaaactggtgttcgaggcagagtgcctgtcatcccatca
gctgtcgcagatcttgatgaatccaattttgataagattgtcaagaaccctgataacaat
gttctggtggagttctttgcaccttggtgtggtcactgtaaaaatcttgctccagtttat
gaaaaagttggtgaagctttcaaaaatgaaccaaattgtgttattgccaaagttgatgcc
gatgctcactccgccctgggccaaaagtatggagtaagtgggtaccccaccctcaagttc
ttttccaaaaccaacaaggacggagaagagtattctagtggacgtgatgaacaatcattt
gtggacttcatgaatgagaaatgtggaaccaaacggacacctggcggaggactgaatgaa
caggctggaagaatcaatgcttttgatggatttgcagtagagttcatgaagaacaaggat
ggtcgtgataatgtttataacaatgctaaatctgctgtggataaacaagacgaccaaaag
atggctacctattacgtgaaagtcatggagcgagtgcagtccaagggagactcgttcatc
cagacagagaccagccgacttgaacgtcttcttgaggggcaaatcagtgcaggcaagaaa
gaccagttcattatgcgtaagaacgtgctatcgcagttcgctaaaggaatggaaagcaag
gaagagctataa

DBGET integrated database retrieval system