KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g239681Help
Entry
NEMVE_v1g239681   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00510  N-Glycan biosynthesis
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    NEMVE_v1g239681
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nve01003]
    NEMVE_v1g239681
Enzymes [BR:nve01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     NEMVE_v1g239681
Glycosyltransferases [BR:nve01003]
 Glycan extension
  N-Glycan
   NEMVE_v1g239681
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-GeneID: 5518907
NCBI-ProteinID: XP_001638889
JGI: 239681
UniProt: A7RNZ8
AA seq 416 aa AA seqDB search
MNWVFILRRFCRLRSFRRTVIFLVVILVQIWLAVPVIFQHIKDNWPETFDVSVPDNFQPP
FLPIVIFSSYRPKYLEKTLRSIASSGNVQPTTPCLFILHHTKHSTMDDINETYKVLGKIT
FCRKLVSTYGNDKEERTPAVLKSHWWLVMKKIFEEKDPFQLKSNSTYTGDVFFIEDDAIL
SPDFMEVMWFSLYVKNTFPETLFSTLQGMGSENLVEHQPDTFVISQVPVVESVCYSFNVT
AWNYIKKVEKESVAYTEKDWPLALGLLLFYDRNETVQIVAPTISRIWHVGGKDLSSTDQS
DIQFGSDNLPPWKKAKEQRYLNMHKARILPGIRDMYGRLCHPCELESRVTKFPSSNFPCR
CFCPVSNFKKYWNWQIAAFVPATKRMVHCQLVSHLMIMVVFIITGVVMFGYLMVSK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgaactgggtatttattcttcgcagattttgcagactgcgttccttcagacggacagtg
atctttctggtcgtcattcttgtccaaatctggcttgctgttcctgtaatctttcaacat
ataaaagataactggcccgagacctttgatgtgtcagttcctgacaattttcagccaccg
tttctacccatagtgattttcagctcatatagaccgaaatatttggaaaagactttgaga
tcaattgcaagctctgggaatgtccaaccaaccacaccgtgtttatttattttgcatcat
acaaaacactctactatggatgacatcaacgagacttataaagtccttggaaaaatcaca
ttctgtaggaagctcgtctcgacctatggcaatgataaggaagaaaggacccctgctgtg
ttgaagtcacactggtggctagtgatgaaaaagatttttgaggagaaagatcctttccag
cttaagagcaacagcacctacactggggatgtgtttttcattgaagatgatgcaattctt
tcaccagattttatggaggtcatgtggttttccttatatgtgaaaaatacctttccggag
accttatttagcaccttacaaggtatggggagtgaaaaccttgttgaacatcagccagat
acttttgttatcagccaagtacctgtggttgaaagtgtctgctattccttcaatgtcact
gcgtggaactatatcaagaaagtagagaaagagtctgtagcttacacagaaaaagactgg
cctttagctctgggtctactgcttttctacgatcgcaatgaaactgtccaaatagtggca
ccaacaattagtcggatctggcatgtagggggaaaggatctctcatccacagaccagagt
gatatccaatttggctctgataatttgcctccgtggaagaaagccaaggagcaaagatac
ctgaacatgcataaagccagaatcctgcctggcattcgagacatgtatggtcgcctgtgc
cacccttgtgagctggaatctcgggtgactaaatttccaagtagcaattttccatgtcgc
tgcttctgtccagttagtaattttaaaaagtattggaactggcagatagctgcatttgta
cctgccacaaaacgtatggtacattgtcagcttgtgtcccatttgatgattatggttgtg
tttataatcactggggtggtgatgtttggatatctaatggtatcaaagtag

DBGET integrated database retrieval system