KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g241086Help
Entry
NEMVE_v1g241086   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nve04131]
    NEMVE_v1g241086
Membrane trafficking [BR:nve04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    NEMVE_v1g241086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398
Motif
Other DBs
NCBI-GeneID: 5516326
NCBI-ProteinID: XP_001636435
JGI: 241086
UniProt: A7RW14
AA seq 2151 aa AA seqDB search
MAATGSSSSATRAFAQKLNKNKPAAEVRRNVVSSVFVSQASKRSSTIDESFLHLASGTVP
LSEVVNPLDFEEFVLQNQPLNDNEPDAHMFDFPDDDIEVTTTPRHCRTVQPTIPKDISLD
SDPHLKDCVHTYQADWSIVNRRYQFRSAEEDKPDSRRRINRSRSFINTLPKQIYESDEKV
KDDQKSNQEKSQDGGSKQQEDAPKGSWASSIFDLQSSQADEQLPTLLNHTPAEEIDQDNY
DQRQLQRIHSVFSVFPAQQEEGIEKRVPPTIPQQHFGQRILVKCLQLKLDLEVEPIFASM
ALYDLRVKKKISENFYFDMNNEWCRKLLKDEKRDISTLSRSAIFSITYPSTDVFLVIKLE
KVLQQGDISECAEPYLKDTDNAKHRDKVRAVAVANCERLGQYRMPFAWTAIHLIDIISGT
VTAGEPSTPQEREGSAANNPNRKSSTIETPPASKTTKRKDAESLPRSYNAMIEQRKSFHG
SHLTHVGDSLDFDVLPDLSNFRPVTLSVSSFFKQESDRLKDEDLYKFLADLKRPTSVLKR
LKCIPGVIKLDISPPGENPPYCLTSSLHQVHPYPDGQGRPTKEIEEFAPREVFSPFVIYE
NLLYIYPQSVNFSSRGTSARNIACKVQIMSGEDEQNCIECIFGKSSCASMSKEAYTHVTY
HNRTPDFNEEIKVKCPAHLTDQHHILFTFYHISCSPGKKPDEKEVETPIGYTWIPMLKDG
RLALGEFNLPVSLDKPPHSYSMLSPEVQLPGMKWVEGHKGVFHVAVRAVSSIHTQDPYIH
KFLKMCHQIEGRMLSPSRNAEGNLEMVLRKSIVDLSKAREEPLVRFLHIIMDKLILLLVR
PPVISGTVVNIGQAAFESLAQIVNRLHLLLENNQDDHNRNDLLASYVTFVFSAPYTLSPT
ATPELYPGDGFSRISASSLHAPHTKLTMSSSNPQLNAAAADDERQGGNGGWEEERRRSGR
DKSNLPGNRSSMAEGRVGSINVPGMPSSNSKKLVHEEIALQWAVASGPVREMAMKHAWFF
FEVMIKSMAQHLDNTDKFFWPRKTRFPDQFLGDLRALVNTTVQEIVNKQNDFAVVQDLNS
SLGFFLYDLLSFIDRGFVFELLKNYCKEMLYQGSLHSSLGQLRLELLRIVCSHEHYVTLN
LPYPTSLYPSEPSSPTTSLSSLSSTTSGDTLTPGSSMAELSVAFRQQHFLVGLLLSELAM
ALEGCDFNLQSQAIDTIRDLLACHDSDTRFDDPVCRRRVAALYLPLLGVVIDARTQLHGY
RAEETSGLNPDVAMAIATSSVASQWYESRPELGTQLSRAQQLSPESTRNLLMGFLWVLKN
MDPTVLVQWWTDQDSSRLGLLLDVLHLCITQFEYTGRKEVRNKNASTAPRSKTLGDAKAT
LEEMFKGEKSAARQMMERHSRAFGQGHLAKVRKTCDRHSRAFSQGHLAKVRKTCDWHSRA
FGQERGASPAAEPKLRWRKEQTQWRPNSSVQEKSGQEADVIASHIEGGLCAEINMVVLDT
LELIVKFPELLFEEDTELCADLCNRLLNHCSSSIGAIRAQASASLYLLMRQNFEIGNNFA
RVKMQVTMSLSTLVGTSHVFSEECLRRSLKTIITYAESDHELKNTTFPEQVRELVFNLHM
ILSDTVKMKEFQEDPEMLVDLMYRIAKGYQNSPDLRLTWLHNMAAKHGELKNDVEAALCI
VHAAALVSEYLSMMEDKRFLPVGCVAFEKISPNVLEESAVSDDVDEEGICTGKYFSENGL
IGLLEQAAIKFMDAQMFECTNEVYKLLIPILEARREYDKLAMVHSKISEAFKKIIQTEGK
RMMGTYFRVGFYGSKFGDLDGEEYVYKEPAITKLPEISHRLQAFYGDKFGEEFVEVIKDS
NAVDRDKLDPNLAYIQLTYVEPFFDEYEMKDRKTYFDKNYNLRTYSPYGHKLQPTCVPYK
LAFGRFLYVTPFTPSGKARGDLCNQYKRKTILTVANSFPYLKTRVSVMHREQIVLSPIEV
AIEDMQNRTHELYNAIYSHSPDAKMLQMVLQGSIGTTVNQGPLEIAIVFLHSDTNADDEP
DLEPQVFNRHHHKLRLSFKEFMKRCGDALHVNKQLIKSDQRAYQKELERNYHKLMEQLEP
LLRNKFGSLRGSMRKKYVRTQLLVSTLVALEILEIHWVSCLGDPVLFVLAP
NT seq 6456 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacgggaagtagttcgtctgcaacccgcgctttcgcacagaaacttaacaag
aacaaaccggcagccgaggtgaggcgtaatgttgtctcgagtgtattcgtgagtcaagca
agcaagcgttcctctaccatagatgaatcttttctacatttggcatcagggacggttcca
ctgtcagaggttgtgaatcctttggactttgaggagtttgtgctacagaatcagccgttg
aatgataatgaacctgatgcacacatgtttgattttcctgacgatgacatagaagtcaca
accaccccccgccactgccgcaccgtgcagccaacaatacctaaagatatcagtcttgat
agtgaccctcatttgaaagactgcgtccacacctaccaagcagactggtctatagtcaac
agaagatatcagttcagaagtgcagaagaagacaaacctgattcaagaagaaggatcaat
cgttctagaagtttcataaacacccttcctaagcaaatttatgagtctgatgagaaagtt
aaagacgatcagaaatcaaaccaggagaaatctcaggatggtgggagcaaacaacaagag
gatgcccccaaaggcagctgggcatcaagtatattcgacctccagtcttctcaggctgac
gagcaactgccaacacttctcaaccatacccctgctgaggagattgaccaagataattat
gaccagaggcagttacagagaattcactctgtgttctcagtcttccctgctcaacaggag
gaaggaattgaaaagagagttccacctaccattcctcagcagcactttggccagagaata
ttagtcaagtgtctacagctcaagcttgatctcgaggtggagcccatctttgccagcatg
gcgctgtatgatcttagagtcaagaaaaagatttcagagaatttttacttcgacatgaac
aacgagtggtgccgcaagctgctgaaggacgagaagcgagacatctcgactctgagtaga
tccgccatcttctccataacctacccttccacagatgtgttccttgtcatcaagttagag
aaggttttgcagcaaggcgatatcagcgagtgcgcagagccttatttgaaggataccgac
aatgcaaagcaccgtgataaagtgcgagcggtggctgtggctaactgtgagcgcttgggc
cagtaccgcatgcccttcgcctggacggccattcaccttattgacatcatcagcggtacg
gtgacagctggggaaccgagtacgccgcaagaaagggaaggcagtgcggcaaacaaccct
aaccgtaagtctagcaccattgagactcctccggcaagtaagaccacaaagcgcaaagat
gccgagagcttaccaagaagctacaacgctatgatagagcagaggaagtccttccatggc
agccatcttacccatgtgggagactcgcttgattttgacgttctgccagacctcagcaat
ttcagacccgtcactctctcagtgtccagcttcttcaaacaggagtctgatcgcctaaag
gacgaggacttgtacaagttcctggcagacttgaagagacccacctccgtgctcaagcgc
ttaaagtgtattcctggggtgataaagttggacatttcccctcctggagaaaacccaccg
tactgtctcacttctagtctacatcaggtccatccgtaccctgatggtcaaggtagaccc
accaaggagatagaagagttcgctcccagagaagtcttctctcccttcgttatatacgag
aacttgctgtacatctacccacagagcgtaaatttctctagtcgcgggacgtcagcacgt
aacatcgcgtgtaaggttcagatcatgagtggcgaagatgagcagaattgcatcgagtgc
atctttggcaagtcaagctgtgcttccatgtctaaggaggcgtatactcatgtcacctat
cataacagaacgcctgatttcaacgaggagatcaaggtgaaatgtcccgcccacctgacc
gaccaacaccatatcctgttcacattctaccacatcagctgctctcctggcaaaaagccc
gacgagaaggaggttgagacgcctattgggtatacgtggatcccgatgctgaaggatggt
cgtttggctcttggcgagttcaacctacctgtgtctttggacaagcctcctcacagctac
agcatgctatcccctgaggtgcagttaccgggtatgaagtgggttgagggtcacaaaggg
gtgttccatgtcgccgtcagagccgtctcctcaatacatacacaggacccgtatatccac
aagttcctgaagatgtgtcatcagatagaaggccgcatgttgtccccatcacgaaacgcc
gagggcaacctcgagatggtgctgcgtaagagcatcgtggacttgtccaaagcacgcgag
gagcccttggtcaggttcctacacatcatcatggacaagttgatcttactgctggtgcgg
ccacctgttatatctggtactgtagttaacatcggtcaggccgcatttgagtctctggcg
cagatcgtaaaccgcctccacttgctcctagagaacaaccaggatgaccataacagaaac
gacctcctggcgtcgtatgtgacctttgtattttctgcaccctacaccctctctccaact
gcaacgcccgagctctacccaggtgacgggttttcgcgcatctctgcttcctctcttcac
gcacctcacaccaagctcaccatgagcagcagcaatcctcagctaaacgcagctgccgcg
gacgacgagcggcaaggaggcaatggaggctgggaggaggagaggaggaggagtggtaga
gacaaatccaacttgcctggcaaccgcagcagcatggcggagggtagagtgggatccatc
aacgtgcctgggatgccctctagcaacagtaaaaagcttgttcatgaggagattgctctc
cagtgggcggttgccagcggacctgtccgagagatggccatgaaacacgcttggttcttc
tttgaagttatgatcaagagcatggctcagcacctggacaacacagacaagttcttctgg
cctcgcaagacgcgcttccctgaccagttccttggcgatctccgtgctcttgtcaacacc
acagtccaagaaatagtgaacaagcagaacgacttcgcggtggtacaggacttgaactcc
agtctgggattctttctgtacgacctgctttcattcattgaccgcggattcgtattcgaa
ctcctaaagaactactgtaaggagatgttgtaccagggaagcctccactcaagccttggt
cagcttaggctggagcttctccgtatcgtctgcagccacgagcattacgtcaccctgaac
ctcccctaccccacctccctgtacccttccgagccctcgtcccccaccacctccctctcc
tccctaagcagcaccacctccggcgacaccctgacccctggtagcagcatggcggagctg
tccgtggcatttaggcagcagcactttctggtgggattactgctgtctgaactcgcgatg
gcactggaggggtgtgactttaacctccaaagccaggccattgatacaatccgcgacctg
ctagcctgccacgactccgacacgcgctttgacgaccctgtgtgcaggagacgagtggct
gccctctacctccccctcctgggggtcgtcattgatgcgcgaacacagctccacggatat
agggccgaggagaccagcggtctcaatcctgacgttgccatggcaatagccacgtcaagt
gtagcgtcacagtggtatgagtcacgccctgagctaggaactcagctttcccgcgcccag
caactcagccccgagtccacgcgcaaccttctcatgggcttcctgtgggtgttgaagaac
atggaccccaccgtgctggttcagtggtggaccgaccaggattcctccaggctgggtctt
ttgctagatgtactccacttgtgcatcacgcagttcgagtacacgggcaggaaggaggtg
aggaacaaaaacgcttccaccgcccctcgtagtaagaccctaggcgacgccaaggcaacc
ttggaagagatgttcaaaggcgagaaaagcgcggcaaggcagatgatggagagacactct
agggcatttggccaagggcatttagccaaggtacgtaagacttgtgaccggcattccagg
gcatttagccaagggcatttagccaaggtacgtaagacttgtgactggcactctagggca
tttggccaagaacgtggagcatcacctgctgcggagccgaaattgaggtggcgaaaagaa
cagacacagtggcgaccaaactctagcgtacaagaaaagtctggtcaggaagctgacgta
atcgcgtctcatatcgagggtggcctctgcgcggagatcaacatggtggtgcttgacact
ctggaacttattgtcaagttccccgaactgctgtttgaagaagacacggaattatgtgct
gacctttgtaaccgactgctcaaccactgtagctcatctattggcgccattcgcgcccaa
gcctccgcttcgctctacttgcttatgagacagaatttcgagattggcaacaactttgcc
cgtgtcaagatgcaagtcacgatgtcactttccacgcttgttggtacctcacatgtgttt
agcgaagagtgcttgcggcgttctttaaagaccatcatcacgtacgccgagtctgaccac
gagctcaagaacaccacgttccctgaacaggtgcgagagcttgtcttcaatcttcacatg
atcctcagtgatacagtcaagatgaaggagttccaagaggatcctgagatgttggtggat
cttatgtatcgcatagccaaagggtaccaaaactccccggacctccggctgacatggttg
cacaatatggctgcaaaacatggcgagctgaagaacgacgtggaagccgcgctgtgcatc
gtgcacgctgctgccctggtctccgagtatctgagtatgatggaggacaagcggttcttg
cccgtcggctgtgttgccttcgagaagatctcgcccaacgtgttggaggagagcgctgtc
tcagacgacgtcgacgaggagggtatttgcactggtaaatacttcagtgagaatggcctg
atcgggttgctggaacaggctgccatcaaatttatggacgcgcaaatgttcgagtgcact
aacgaggtgtacaagctgctgatccccatccttgaggcgcgcagagagtacgacaagctg
gccatggtgcatagcaagatcagcgaggcgttcaagaagattatccagacggaaggcaag
cgtatgatgggcacgtatttccgtgttggtttctacggatccaaattcggcgaccttgac
ggggaggaatatgtttacaaggagcccgcgattacgaaactccctgagatctctcacaga
ctccaggcattctacggggataaatttggcgaggagttcgttgaagtgatcaaggattcg
aatgcggtggaccgcgacaagttagaccctaacttggcgtacatccagttgacttacgtg
gagccgttttttgatgagtacgagatgaaggaccgaaaaacctacttcgacaagaactac
aacttacgtacgtattctccttatggacacaaattacaacctacatgtgtaccttacaag
ctggcttttggtcgctttctgtatgtcacgccattcacgcctagtggtaaagctcgtggc
gacctttgcaaccagtacaagcgaaagacgatactcacagtggcaaactccttcccgtac
ctcaagacgcgagtatccgtcatgcaccgcgagcagatcgtgctgagccctattgaagtc
gccatcgaggatatgcagaacaggacgcacgagttgtataatgccatctattcgcattca
ccagacgccaagatgttacagatggtgctacaggggtctatcggcacaaccgtcaaccag
ggtccactagagatcgccattgtgtttctacactcagacacgaatgcggacgatgagccg
gacttggagccgcaagtgttcaacaggcatcaccacaaactacggctatcattcaaagaa
ttcatgaagaggtgcggtgacgccctccacgtcaacaagcagctcatcaagtcagaccag
cgcgcctatcagaaggaactcgagcgcaactaccacaagctcatggaacagctagagcca
ctccttaggaacaagtttggatcgctccgaggctccatgaggaaaaagtatgttagaact
caacttttagtatcaacgttagtcgctctcgagatattggaaattcactgggtttcttgc
cttggtgatcctgtgcttttcgtcctggcaccctga

DBGET integrated database retrieval system