KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g241973Help
Entry
NEMVE_v1g241973   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00511  Other glycan degradation
nve00520  Amino sugar and nucleotide sugar metabolism
nve00531  Glycosaminoglycan degradation
nve00603  Glycosphingolipid biosynthesis - globo and isoglobo series
nve00604  Glycosphingolipid biosynthesis - ganglio series
nve01100  Metabolic pathways
nve04142  Lysosome
Brite
KEGG Orthology (KO) [BR:nve00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NEMVE_v1g241973
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    NEMVE_v1g241973
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    NEMVE_v1g241973
   00604 Glycosphingolipid biosynthesis - ganglio series
    NEMVE_v1g241973
   00511 Other glycan degradation
    NEMVE_v1g241973
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    NEMVE_v1g241973
Enzymes [BR:nve01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NEMVE_v1g241973
Chaperones and folding catalysts [BR:nve03110]
 Intramolecular chaperones
  Others
   NEMVE_v1g241973
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX CHB_HEX_C Glyco_hydro_20b
Motif
Other DBs
NCBI-GeneID: 5514724
NCBI-ProteinID: XP_001634886
JGI: 241973
UniProt: A7S0E8
AA seq 971 aa AA seqDB search
MAAKIDLRYDVISNLQGDGRYSAKLTLTNTGTTVITKGDWDLVFCSIRLIVPDSSTERAG
VKVSHINGCLHKMTPLETFPVLAADQNVEIPFRAMNWVVAKTDIMPNWFFAADGLEPRVV
KSTEGEGLSFVGKFTTEEQWKRYANDQYNPYTAQGRYDVIGFDDLGEDGWGDIVTIPQPM
TVQGLERKSRVGIRADWKIFADGGFQKEAQLLKAKFNAQIASSMPFNQSKLIRLVKGDPN
VTRGVASSEAYSLEIKVAEKEIKLTGSHASGVFYGVQTLIALADKENTVPMVTIKDAPRY
GYRGMHLDVGRNFMEKAAVLKLLDAMATYKMNKFHFHLTDDEGWRLEIPGLEELTTVGSK
RCYDINTTRCILSQLGSGPSPSTSAQYYSVSDYKEILKRANDLHIQVIPEFDMPGHGYAA
IKSMEARFKRLKDSNPSEASKYILSDFNDTSKYLSIQYFTDNAINPCIESTYAFIEKVLT
EVKSMHKDIQPLTVYHFGGDEVAHGAWTKSSACEQLAQRMGYNLTGSDIVDKLKGYFVER
VANITVNDGLSLAGWEDGLLGHGEVPYNRKSFRNSNVMAYAWNNIWEWGSGKRAYLLANA
GYKVVMTQATHLYFDFPYEPDPQERGYYWATRFTDTRKTFGFMPDNLFNNVEQKVTGEPL
TREELCKTEGMCVELVKKENIIGMAGALWTETVRTADQMDSMIFPRLLAVAERAWHKASW
EDISDKTERNNKRSEAWKRFATYLGHLEMTRLDAMKIKYHLPPPGARVENSKLKVRTAIQ
GLPVQFSKDDGKTWSDVTDSTEVRGKLVLRTKSADGTRQSRLVTLNMDVSVASRLSVARE
KGTTKAQRVPFEKKNSPIGRQRQGKGYRKEHRSTQEINKNIRFMILESNQEFKQKFHVFN
LRVQDLAREAEEKESIIRERESEISALSMEHEDALEREHQYQKELDYAWKRILRCENKIR
HLIDELEFYRT
NT seq 2916 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaaaattgatctgcgctatgacgtcatctccaatctccaaggcgacggaagg
tatagtgcaaagctcacactgacaaacaccggaacgaccgtgataaccaagggggactgg
gacctggtattttgctctataaggctcattgttccggacagcagcaccgaaagagcggga
gtgaaagtcagtcacattaacggctgtcttcataagatgacgccccttgagactttccct
gtattggcagccgatcagaatgtagagattccttttagagcaatgaactgggtcgtcgcc
aagacagatattatgccgaattggttttttgccgcggatggactggagcctagagtggtg
aaaagtactgagggggaggggctaagttttgttggcaaatttaccacggaagagcagtgg
aagcgatatgcgaacgatcaatacaacccatacacagctcaaggcagatatgacgtcatt
ggttttgatgacctcggggaggatgggtggggagatattgtcaccattccacagccaatg
accgtgcagggcctggagaggaaatcacgtgttgggattagagctgactggaagattttc
gctgatggcggattccagaaagaggcacagcttctcaaagctaagttcaatgcgcaaatc
gcatcttccatgccattcaaccagtcaaagctcatccgattggtcaagggtgatcctaac
gtcacaagaggcgtggcttcgtctgaggcgtacagtctcgaaatcaaggttgcagaaaaa
gagataaaactgacgggtagccatgcatccggggtcttctatggcgtacaaaccctgatt
gccttagctgacaaagaaaataccgttcccatggtaaccatcaaggacgcccctagatac
ggctatcgcgggatgcaccttgatgttggacggaacttcatggagaaagccgctgtcctg
aagctgttggatgccatggcaacatacaagatgaataaattccattttcaccttacggac
gacgagggctggagactagaaatccctggactggaggagcttacgacggttggctccaag
cgttgctatgacatcaacaccaccagatgcatcctttctcagctaggttcaggcccctct
ccgtccacctccgcccagtactactctgtcagtgattacaaagaaatcctgaaacgcgcg
aatgatcttcacattcaagttatccccgaattcgacatgccggggcatggttacgccgca
atcaaatccatggaggcgaggtttaaacggctgaaagattcaaaccccagcgaggcttca
aaatatattttatcggacttcaatgacacttcgaaatatttatccattcagtatttcacg
gataatgccatcaatccttgtattgaatcaacttacgcttttattgagaaagtcctcacc
gaagtcaagagcatgcacaaagacatccaaccgctgaccgtgtatcactttggcggggac
gaagtggcgcatggggcctggaccaagtccagcgcctgcgagcaattagctcagcggatg
gggtataaccttaccggaagtgacatcgtggataagctgaaggggtatttcgttgagcgc
gttgcaaacataactgttaatgacggcctcagtctagcgggctgggaagatgggttgtta
ggacacggcgaagtcccgtataaccgaaagtcgtttcgaaattccaacgtgatggcgtat
gcgtggaataacatctgggagtgggggtctgggaagagggcgtatctactggcgaacgct
gggtataaggtggttatgacccaggccactcacctttacttcgacttcccgtacgagcct
gacccgcaggagcgtgggtactactgggcaactcgattcaccgacacccgaaaaacgttc
ggatttatgcctgataacctgttcaataacgtcgagcagaaagtcacaggagaacctcta
acacgagaggagctttgcaagactgagggcatgtgtgttgaacttgttaagaaggaaaac
atcattggcatggcgggagccctgtggaccgagaccgtgcgaaccgctgaccagatggac
agcatgatcttcccgcgtcttctcgctgttgcggaacgcgcgtggcacaaggcatcatgg
gaagacataagcgacaagactgagcgtaacaataagcggtctgaggcatggaaacgattc
gccacctacttagggcatctcgaaatgactaggcttgacgctatgaaaatcaagtaccat
ctaccaccccctggggctagagtcgagaactcaaagctcaaagtccgaactgctatacaa
gggctacctgtacagttctcaaaggatgatgggaagacatggagcgacgtaactgattcg
acggaagtgcgtggcaaactcgtgctgcgcacaaagtcagcggatggcacccgccagagc
aggctcgtaacattgaacatggatgtgtctgttgcttcacgcctttcggttgcacgggag
aagggaacgacaaaggctcaaagagttccttttgagaaaaagaatagtcccattggtcga
caaagacaaggaaaaggatatcgaaaagaacaccgatctactcaagagattaacaagaat
atccgatttatgattttggagtcaaatcaagaattcaaacaaaagtttcatgtcttcaat
cttagagtgcaagatttggcaagagaagcagaagagaaagaaagcatcatacgtgaaaga
gagagtgaaatcagtgcgctttcgatggaacatgaagacgcacttgaaagggaacatcag
tatcaaaaggagttggactatgcgtggaagaggatattgagatgcgagaacaagatcagg
catttaatagatgaactcgaattttaccggacttga

DBGET integrated database retrieval system