KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g246101Help
Entry
NEMVE_v1g246101   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K07561  2-(3-amino-3-carboxypropyl)histidine synthase [EC:2.5.1.108]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:nve03012]
    NEMVE_v1g246101
Enzymes [BR:nve01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.108  2-(3-amino-3-carboxypropyl)histidine synthase
     NEMVE_v1g246101
Translation factors [BR:nve03012]
 Eukaryotic type
  Elongation factors
   Elongation associated factors
    NEMVE_v1g246101
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Diphthamide_syn
Motif
Other DBs
NCBI-GeneID: 5506664
NCBI-ProteinID: XP_001627380
JGI: 246101
UniProt: A7SLX5
AA seq 465 aa AA seqDB search
MADSVEQSSVTTKRISAKGARKRFVGTKSASGKHSQGVDRVGSAAHRPVNQIPEEILKDT
KLQEALPENYNFEIHKTIWRIQQVKAKRVALQFPEGLLLFACTIADILESFTGCETVIMG
DVTYGACCVDDYSARALGCDLLVHYGHSCLVPIDATAGIKMLYVFVDIKIDTAHFVESVR
FNLGAGSCLALVSTIQFVAALQAASNELSKDYQVEIPQCKPLSPGEILGCTAPMLKDKDA
VIYLGDGRFHLEAVMIANPAIQAYRYDPYDKTFSKEYYDIDKMHEARQTAIKQASLASKY
GLILGTLGRQGSPKVLQTLEKQLQSLNMDYIIVLLSEVFPDKLKLFKDVDAWVQVACPRL
SIDWGTAFPKPLLSPYEASVALQSVAWQQSYPMDFYAYSSLGGWTPNNESNRPTPANRRK
KNLHTEVIIDNVSDSKPVIKESECGSGETCCGKCTKETDKHSSTP
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atggcggacagcgttgagcagtcttcggtgactaccaagaggatttctgcgaaaggagcc
cgtaagagattcgttggaacgaaatctgcgtcgggaaaacactctcagggtgtagataga
gttggctctgctgctcaccgtcctgtcaatcagataccagaggaaattctcaaagacaca
aaattgcaagaggcgcttcctgaaaactacaattttgagatacacaaaactatatggaga
atacagcaagtaaaggccaaacgagttgcacttcagttccctgagggacttctactattt
gcttgtacaatagcagacattctagagagttttaccggatgtgagactgtcataatggga
gatgtgacatatggtgcatgctgtgtggatgattactccgcccgtgcgctagggtgtgac
ctcctggttcattatgggcacagttgcctagtccctatagatgcgactgcagggattaaa
atgctttatgtttttgtggatatcaagattgatacagcacactttgttgagagtgtgcgg
tttaatcttggtgcaggatcctgcctcgcccttgttagcaccatacagtttgtggcggct
ctccaggcagcatcaaatgaactctctaaagactaccaggtagaaatacctcagtgcaaa
cccctatcccctggtgagatcctgggatgcaccgccccaatgctcaaagacaaggatgct
gtcatctaccttggtgatggcaggtttcatttggaggcagtgatgattgccaatcctgct
atccaagcttacagatatgacccatatgacaaaaccttcagcaaagagtactatgacatt
gacaaaatgcatgaagccagacaaacagcaataaagcaggcgtcactagcgagtaaatac
ggcctgatactaggcactcttgggagacaagggagtcctaaagttttacagactctggag
aagcaacttcaatcactcaacatggactacataattgtgttgttatctgaggttttccct
gacaaactcaagctcttcaaagatgttgatgcatgggtacaagttgcatgtccaagatta
tcaatagactggggaacagcttttcccaagcccctactgtcaccatatgaggcatcagtt
gcattacagtcagttgcctggcaacaaagttaccccatggatttctatgcatattcaagc
ttagggggctggactcctaacaatgagagtaatcgacctactcctgccaaccgtaggaag
aaaaatcttcacacagaagtaataatagataatgttagtgacagcaaacctgtcatcaag
gagagtgagtgtggttctggggaaacctgttgtggaaaatgtaccaaggaaacagacaag
catagtagcacaccatag

DBGET integrated database retrieval system