KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g246109Help
Entry
NEMVE_v1g246109   CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00020  Citrate cycle (TCA cycle)
nve00640  Propanoate metabolism
nve01100  Metabolic pathways
nve01200  Carbon metabolism
Module
nve_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nve_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NEMVE_v1g246109
   00640 Propanoate metabolism
    NEMVE_v1g246109
Enzymes [BR:nve01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     NEMVE_v1g246109
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NEMVE_v1g246109
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 5506690
NCBI-ProteinID: XP_001627384
JGI: 246109
UniProt: A7SLY9
AA seq 331 aa AA seqDB search
MAFRVALRRFGASIEQLGIRHCYNNTRKNLNINKDTKVICQGFTGKQGTFHSQQSIEYGT
NMVGGVSPGKGGKTHLGLPVFDTVQEAKNETGADATVIYVPPPYAADAIHEAIEAEIGLI
VCITEGIPQQDMVKVKRRLTEQGKSRLIGPNCPGIIKPGECKIGIMPGHIHHPGVIGIVS
RSGTLTYEAVHQTSHVNLGQSLCVGIGGDPFNGTNFVDCLEVFLNDPGTKGIVLIGEIGG
GAEEKAAEYLAENNTGDNAKPVVSFIAGVTAPPGRRMGHAGAIIAGGRGGAEHKIQALKD
AGVNVTMSPAQMGSMMRKVFDQHYSNANTDI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttcgcgtggcactgagacggtttggtgctagtatagagcagttgggcatccgc
cactgctacaataacaccaggaaaaacttaaacatcaacaaggacaccaaagtcatttgc
cagggttttactggaaaacagggtacatttcatagccagcagtctattgagtatggtacg
aatatggtcggtggtgtatcccctggtaagggtggcaagacacacttgggccttccagtt
tttgacacagtgcaagaggccaagaatgaaactggtgctgatgcaactgtgatctacgta
cctcctccatacgctgcagatgccattcatgaggccattgaggcggagattggtctcatt
gtgtgtattacagaagggattccccagcaagatatggtcaaggtgaagcgaaggctaacg
gaacagggaaaatctagattgatagggccaaattgtccagggattattaagccaggagag
tgtaagattggtatcatgcctgggcacattcaccaccctggagtgattgggattgtgtct
agatcagggaccctgacgtatgaggcggtacaccagacgtcacatgttaacctcgggcaa
tccctctgcgtaggtattggtggcgatccgttcaatggcacaaactttgttgactgttta
gaggtcttccttaatgaccctggaaccaaagggattgttcttattggtgagattggtggt
ggagcggaggagaaggcggcagagtatctggctgagaataacactggagataatgccaag
cctgtcgtgtcgttcatcgcgggtgtaacagcccctccaggaagaagaatgggtcatgct
ggtgctattattgctggtggtcgcggaggggcagagcataagattcaagccctgaaggat
gctggtgttaacgtgacgatgtctcctgcccagatgggctctatgatgcgcaaggtcttc
gatcagcattacagtaacgccaatacagatatataa

DBGET integrated database retrieval system