KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g40000Help
Entry
NEMVE_v1g40000    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve00230  Purine metabolism
nve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nve00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    NEMVE_v1g40000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nve01001]
    NEMVE_v1g40000
Enzymes [BR:nve01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     NEMVE_v1g40000
Protein kinases [BR:nve01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   NEMVE_v1g40000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc Pkinase_Tyr Pkinase HNOBA Baculo_p24
Motif
Other DBs
NCBI-GeneID: 5505602
NCBI-ProteinID: XP_001626375
JGI: 40000
UniProt: A7SPS9
AA seq 518 aa AA seqDB search
NINQRQIFTTVGIYKSNMVAIKRINKRQIELTREIKYEMKLMRTVRHENLVTFTGACVEP
PNICILLQYCPKGSLQDILENEDIKLDSMFVNSLLTDIVKGMAYLHSTEIRSHGRLKSPN
CVVDGRWVLKITDYGLNKFKSNQDISEEEGEYAMYYRKLWTAPELLRAADPRPRGTQKGD
VYSFGIIVQELLTRSGPFDLSYYTNEPSDIIEKVTRVESPPFRPKLSTIVLEGPTVAGIV
DLAKWCWEENPDHRPDFEEIRKTVRKLPMGKQSNIMDNMVNLLEKYANNLESLVEERTSQ
LADEKRKTENLLNRMLPPSVAKDLVHGKQVTAENFDEVSIFFSDIVGFTSLSSESTPLQV
VDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREID
SFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHIS
PSTKRILDELGGYHIQKRGKVFLKGKGTWITYWLVGSD
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
aatatcaaccagcgtcagatattcaccacagtcgggatatataagtccaacatggtggcg
atcaagaggattaacaaacgtcaaattgagctgacgcgagaaatcaaatacgagatgaaa
ctgatgcgcactgtaaggcacgagaacttggtgacgttcaccggcgcatgcgtagagcca
cctaacatctgcatcttgctgcaatattgtcccaagggcagcttacaggacattttggag
aacgaagacattaaattggatagcatgtttgtgaactcgctgctcacagatatcgtcaag
ggaatggcatacctacatagtacagagattcgctcccatggtcgactcaagtccccgaac
tgtgtggtggatggccgctgggtactcaaaatcactgactacgggcttaacaaattcaag
tcgaaccaggatattagtgaagaggagggagagtacgccatgtattaccgtaagctttgg
actgcaccggagcttcttcgagcggctgacccacgaccaagggggacccagaaaggcgat
gtgtacagctttggtatcatcgtacaagagttgctcacgcgatcagggccattcgacttg
tcttactacactaacgaaccttcagatataatcgagaaagtgacgcgtgtcgagagtccg
ccctttcgtccaaagctcagtaccattgtcctggaagggccgaccgtggctggtattgtt
gacctggctaaatggtgctgggaggaaaacccagatcatagaccggactttgaagagata
agaaagaccgtcaggaaactgcctatggggaagcaatcgaacattatggataacatggta
aatttgttggaaaaatacgccaataatttagagagtttggtggaagaaagaacaagtcag
ctagcagacgagaaacgaaaaacagaaaacttactgaacagaatgttaccaccatcagta
gccaaggatttggtgcatgggaaacaagtaacagccgagaactttgacgaagtctctata
tttttcagtgatattgttggatttacgtcactttcctcagaaagtaccccactacaggtc
gtggacttgttgaatgacttgtacactctcttcgatgaaatcatcaacaactacgatgtc
tacaaggtagagacgataggtgacgcgtacatggtggtcagcggtctgcctatccgtaac
ggtcaccagcacgcgggtgagattgctactatggcactgcatatgctccgggagatcgac
tcgttcaagatccgacaccggcctaacgacaaactcaagctccgtatcgggatacactcg
ggctcgtgtgtagcgggagttgtgggcaagaaaatgccacggtattgtttatttggagat
accgtaaatacggcctcgagaatggagtcgaacggagaagcgttaaagattcatatcagt
ccgtcgacaaagcgaatccttgatgagcttgggggataccacatccaaaaaaggggaaaa
gtcttcctcaagggtaagggtacatggatcacgtactggctcgtgggctcagat

DBGET integrated database retrieval system