KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g62201Help
Entry
NEMVE_v1g62201    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
nve  Nematostella vectensis (sea anemone)
Brite
KEGG Orthology (KO) [BR:nve00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:nve01002]
    NEMVE_v1g62201
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nve04147]
    NEMVE_v1g62201
Enzymes [BR:nve01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     NEMVE_v1g62201
Peptidases [BR:nve01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   NEMVE_v1g62201
Exosome [BR:nve04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   NEMVE_v1g62201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S15 Lipase_3 LIDHydrolase
Motif
Other DBs
NCBI-GeneID: 5520955
NCBI-ProteinID: XP_001640760
JGI: 62201
UniProt: A7RIF7
AA seq 177 aa AA seqDB search
LGDGQPIFLYLHGNAFNRAEPHRVALYQVLSKLSFHVVTFDYRGFADSEGHPSEEGLIED
GLTVWKWIKRRSKKAPVYIWGHSLGSGVATGVAERLTQMRAPPKGLILEAAFNSVYDAGL
DHSLAKPFKFLPYFHEVVMESFKGVFETDKRLGNVNCPVLMLHDHDDDIIPFKYGKK
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
cttggggatggtcaacctatatttctttatctccatggcaatgccttcaatagggcagaa
cctcatagagtagccttataccaggtgttatcaaagctttccttccatgttgtgacattt
gactatcgaggatttgctgactcagaaggccacccatcagaggaaggtctcattgaagat
ggtttaacagtttggaaatggatcaagagaagaagtaaaaaagcacctgtctacatttgg
gggcattccctaggatccggagtggccacaggtgttgccgaaaggctgacacagatgaga
gcaccacctaaaggtctcattcttgaagctgcattcaacagtgtatatgatgctggactt
gaccactctcttgcaaagccattcaagtttctaccatactttcatgaggttgtcatggaa
agcttcaagggagtctttgaaactgacaaaaggctgggaaatgttaactgcccagtactg
atgcttcatgatcatgatgatgatattatccccttcaagtatggtaaaaag

DBGET integrated database retrieval system