KEGG   Nematostella vectensis (sea anemone): NEMVE_v1g93668Help
Entry
NEMVE_v1g93668    CDS       T01037                                 

Definition
(RefSeq) hypothetical protein
  KO
K11866  STAM-binding protein [EC:3.4.19.12]
Organism
nve  Nematostella vectensis (sea anemone)
Pathway
nve04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:nve00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    NEMVE_v1g93668
Enzymes [BR:nve01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     NEMVE_v1g93668
Peptidases [BR:nve01002]
 Metallo Peptidases
  Family M67
   NEMVE_v1g93668
Membrane trafficking [BR:nve04131]
 Endosome - Lysosome transport
  Others
   Others
    NEMVE_v1g93668
Ubiquitin system [BR:nve04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   JAMM
    NEMVE_v1g93668
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: USP8_dimer JAB Prok-JAB
Motif
Other DBs
NCBI-GeneID: 5517062
NCBI-ProteinID: XP_001637034
JGI: 93668
UniProt: A7RU83
AA seq 394 aa AA seqDB search
MAAARECLPANEKIHKLAEHASHVDVDSNIPPKRYFRSGVELERMAKIYQDERNYESAFI
LYTKYITLFVEKLPQHPEYASVTKQDKALTMKKLPKIFAIAEELKRILTQRYEEEYKTWQ
EIKQKQERKRAEQQLVRELEERENSAPVTVTPSAPPPPLDGPLSSTLIGDYPAPPTLRTI
NSNSTITGDNTRSHTTPNETFVVEPPSPSYASLFSVITDAPSVDRSTKPCDATSGTPTVH
GLRRVSVPSSLVSRFLEIASHNTRRNMETCGILTGSLQQNQFCITHLVIPKQTSTTDSCT
TLSEEDMFEYQDSHNLITLGWIHTHPTQTAFMSSVDLHTHCSYQLMMPEAIAIVCSPKYN
ETGVFTLTQNYGLQFVASCKKHGFHPHPKEPPLY
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgcaagagaatgtttacctgcaaatgagaaaattcataaattagcagaacat
gctagccatgtggatgtagatagcaatatcccgcctaaaagatacttcaggtccggcgta
gaacttgaaagaatggcaaaaatataccaagatgagagaaattatgaaagtgcatttatt
ttgtacacaaaatatatcacgttatttgttgaaaaactgcctcaacatccagaatatgct
agtgtcacaaaacaagacaaagcgttaaccatgaagaaacttcctaaaatatttgcaata
gcagaagaattaaaacgaatactaacacaacgatatgaagaggaatacaagacatggcaa
gagataaagcagaaacaggaaaggaaacgcgctgagcaacaactagtgagggaattagag
gagcgtgagaattctgcacctgtgactgtgacgcctagtgccccaccccctccattagat
gggccactttcctctacgctcatcggggactaccctgccccacccacgctgaggaccata
aatagcaatagcaccataactggcgataacaccaggagtcacacaacccctaatgagact
tttgttgttgagccaccttcaccgtcttatgcgtcacttttctctgtcatcactgatgca
ccatctgtggatagatctaccaagccatgtgatgctaccagtggcacaccaactgtacat
ggactgcgtagagtgtctgttccatcttctcttgtcagccgcttcctagagattgcctca
cataacactagacggaatatggaaacctgtggcatcctaactggaagtctgcaacagaac
cagttttgtattacccaccttgtgattccaaagcaaacttctacaacagattcctgtaca
acactgagtgaggaagacatgtttgagtatcaggactcacacaatctcatcacgctaggc
tggattcatacccacccaacacagacggctttcatgtccagtgttgaccttcacactcac
tgctcttaccaactcatgatgccggaggccattgccattgtctgttctccgaagtataat
gagacgggtgtatttactctgacccagaactatggactgcagtttgtggcttcctgtaaa
aagcatggatttcacccccatcccaaagagccaccattatac

DBGET integrated database retrieval system