KEGG   Nasonia vitripennis (jewel wasp): 100113577Help
Entry
100113577         CDS       T01081                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00010  Glycolysis / Gluconeogenesis
nvi00562  Inositol phosphate metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100113577
   00562 Inositol phosphate metabolism
    100113577
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     100113577
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     100113577
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 100113577
NCBI-ProteinID: XP_016845164
NASONIABASE: NV19023
Position
Un
AA seq 442 aa AA seqDB search
MVKTILVLFVYIFTTILTHGTLSQKCFENSEQIHCKLGSKTPYRFIANYNDSRYIYTGCS
EKKMWLVVRHGTRYPGKKHVKPMIKKLPKLKKKIVQSNNQNNSELSHDTIEKFNKWTLSF
DEKQTMILANEGENELIDLAERMQSRFPNILVDNYDPELYKFKYTATQRTEKSAQSFVLG
LFGQYHSANITFPKPEQKDPILRFYKRCERWRTEIDKNPETYKEKELFIKSETFQKVVSD
ISQRLGLKLDYESVNLIYLICAFETAWNKTGKSPWCDTLSLDNMKVLEFMEDLEYYWVDG
YGHQLNYNQACPALRDMFTFFDSNDKSLVTAYFTHSGTILKMLSILGIGKETNPLTHESF
LSHKDRNWKVSLIDAFASNIAFVLYDCKVQGPSVLVLHQERPVQISGCPPEALCPLSIMK
KHLPDTEQECQFDAMCTSSKET
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaacaattttagtattgtttgtttacatttttactacgattttgacacacggg
acattgtcacaaaaatgttttgaaaatagtgaacaaatccactgcaaattaggctcaaaa
actccatacaggtttattgccaattacaatgactcacggtatatttatactgggtgctca
gaaaaaaaaatgtggttagtcgtacgtcatggaacaagatatcctggaaaaaagcacgtt
aaaccaatgataaaaaaactgccaaaattaaaaaagaaaattgtacaaagtaacaatcaa
aataactccgaactgtcacatgacacgattgaaaaatttaataagtggactctatctttt
gatgaaaagcagacaatgattttagcaaacgaaggagagaatgaacttattgatcttgca
gaaagaatgcagtcacgatttccaaatatacttgtagataactacgatccagaattgtac
aagttcaaatacaccgccacacaacgtacagaaaaaagcgcgcaatcttttgtacttggt
ctatttggtcaatatcacagtgcaaacattacatttccaaagcctgaacaaaaagatcct
attttaaggttctataaaagatgcgaacgttggcgcacagagatagataaaaatccagaa
acttacaaggaaaaggaattattcatcaaaagtgagacatttcaaaaagttgtatctgat
atttcccagcgattaggcttaaaacttgactatgaaagcgtgaatctgatctacttgata
tgtgcttttgagacagcttggaataaaactggcaaatcaccatggtgtgatacattatca
cttgacaatatgaaggttttggaatttatggaagatttagaatattattgggttgatggc
tatggtcatcaacttaattacaatcaagcatgtccagctcttagagatatgttcacattt
tttgactctaatgacaagtctttagtgacagcgtattttactcactctggcacaatactc
aagatgctatcaatattaggcataggaaaagaaacaaatcctttgactcatgaatccttt
ttaagtcataaagatagaaattggaaagtcagtctcatagatgcttttgcaagcaacata
gcttttgttttgtatgattgtaaagtacaaggtccaagtgtccttgtgttacatcaagaa
cggccagttcaaatttctggttgtccaccggaagcattgtgtcctctatcaataatgaaa
aaacatctgcctgatactgaacaagaatgccaattcgatgccatgtgtacttcaagtaaa
gaaacatga

DBGET integrated database retrieval system