KEGG   Nasonia vitripennis (jewel wasp): 100113628
Entry
100113628         CDS       T01081                                 

Name
(RefSeq) protein transport protein Sec61 subunit beta
  KO
K09481  protein transport protein SEC61 subunit beta
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03060  Protein export
nvi04141  Protein processing in endoplasmic reticulum
nvi04145  Phagosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    100113628
   04141 Protein processing in endoplasmic reticulum
    100113628
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100113628
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:nvi02044]
    100113628
Secretion system [BR:nvi02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   100113628
SSDB
Motif
Pfam: Sec61_beta
Other DBs
NCBI-GeneID: 100113628
NCBI-ProteinID: XP_001599008
NASONIABASE: NV18747
UniProt: A0A7M7G1Q7
Position
4
AA seq 95 aa
MPAAPSSTSVGAASRSPSKAVAPRAGLGGTVRQRKAAPATSARNRNTGTNSGGMWRFYTD
DSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
NT seq 288 nt   +upstreamnt  +downstreamnt
atgcctgctgcaccaagctctacatcggttggagcagccagtcgctctcccagtaaggct
gtagctcctcgtgcaggtttggggggtactgtgaggcaacgcaaagctgcaccagccacc
tcagccaggaatcgcaatactggtaccaactctggtggtatgtggagattctatacagat
gactcccccggaatcaaagttggccctgtacctgttttggtgatgtcactgctgttcatt
gcatccgtattcatgctgcacatctggggaaaatacactagatcttaa

DBGET integrated database retrieval system