KEGG   Nasonia vitripennis (jewel wasp): 100113629
Entry
100113629         CDS       T01081                                 
Name
(RefSeq) 60S ribosomal protein L34
  KO
K02915  large subunit ribosomal protein L34e
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100113629
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nvi03011]
    100113629
Ribosome [BR:nvi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100113629
  Archaea
    100113629
SSDB
Motif
Pfam: Ribosomal_L34e FYVE
Other DBs
NCBI-GeneID: 100113629
NCBI-ProteinID: XP_001601949
NASONIABASE: NV11042
UniProt: K7IPQ5
Position
2
AA seq 119 aa
MVQRLTYRRRLSYNTKSNRRRVVRTPGGKLVYQYLKKPKKIPRCGQCKDKLRGIQPARPM
ERSRMCRRKKTVKRVYGGVMCHKCVKERIVRAFLIEEQKIVIKVMRAQQASVKTKKAEK
NT seq 360 nt   +upstreamnt  +downstreamnt
atggtgcagcgtctaacctaccgacgacggctgtcgtacaacacaaaaagtaacaggaga
cgagtcgtccgtactcctggaggtaaactggtctaccagtaccttaagaagcccaagaag
atccccagatgtggtcagtgcaaagacaagctcaggggtatccagccggctaggcctatg
gaacgctcccgcatgtgccgcaggaagaagactgtcaagcgtgtctatggtggagtgatg
tgccacaaatgcgtcaaggaaaggattgtccgtgccttccttattgaagaacagaagatt
gtcattaaggttatgagggcacaacaggcttctgtcaagacgaaaaaggcagagaagtaa

DBGET integrated database retrieval system