KEGG   Nasonia vitripennis (jewel wasp): 100113917
Entry
100113917         CDS       T01081                                 

Definition
(RefSeq) max dimerization protein 1 isoform X1
  KO
K09114  MAX dimerization protein
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:nvi03000]
    100113917
Transcription factors [BR:nvi03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Mad/Max
    100113917
SSDB
Motif
Pfam: HLH KASH_CCD CCDC106
Other DBs
NCBI-GeneID: 100113917
NCBI-ProteinID: XP_001607135
NASONIABASE: NV10716
UniProt: K7INS8
Position
5
AA seq 244 aa
MSIAALLQAAEYIERRDREAEHGYASTMPIPDDIRTVTKRPKTKKSQGSRTTHNELEKNR
RAHLRNCLEKLKVLVPLGPETSRHTTLGLLTKAKRFIKSLEERDRKHAVHKEQLSREQRF
LRRRLEQLTGQPGLHGLHGLSSSAPAASSCGAAAAAAAAMLSKRRSVSECSVGTASSTSS
TGSSRNSDRSAGSPSVSESDEVDVIGYTSNQSDTDDHSSVQSSSDSGVAMSTSRLTLSEM
MDNL
NT seq 735 nt   +upstreamnt  +downstreamnt
atgagcattgctgccctcctgcaggccgctgagtatatcgaacgaagggacagagaagcc
gaacatggatacgcttcaacaatgccgataccggacgacatccgaacggtcaccaagagg
ccaaagacgaaaaaatcccaaggaagcaggacgacgcataacgagctggaaaaaaatagg
agagcccatctcaggaactgcctcgagaagctgaaagtgctggtgcccttaggtccagaa
acgtcgaggcacaccacgctcggcctcctgaccaaggccaagcgttttattaagagtctg
gaggagcgagacaggaagcacgcggtgcacaaggaacagctgtctcgggagcagaggttc
ctgaggcgcaggctcgaacagctgacgggtcagccaggtttacacgggctacacgggctg
agctcgtcggctccggcggcgtcgtcctgtggcgcggctgcggcagccgcggcggccatg
ctctccaagaggcgaagcgtctccgagtgctcggtgggcactgcatcgtccaccagctcc
acaggcagctccaggaactccgacaggtctgcgggcagtccatccgtctcggagtccgat
gaggtcgatgtgattggatacacgagcaaccagtcggacaccgatgaccatagcagcgtg
caaagcagcagcgacagcggcgttgcgatgtccacctccaggctgaccctttccgagatg
atggacaatctttag

DBGET integrated database retrieval system