KEGG   Nasonia vitripennis (jewel wasp): 100113998
Entry
100113998         CDS       T01081                                 
Name
(RefSeq) protein SGT1 homolog isoform X1
  KO
K12795  suppressor of G2 allele of SKP1
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: SGS CS MoCoBD_2
Other DBs
NCBI-GeneID: 100113998
NCBI-ProteinID: XP_008213869
NASONIABASE: NV17374
UniProt: A0A7M7HAG6
Position
1
AA seq 219 aa
MADEPAKNEVQDNQMPAPKIKHDWYQTETHVIVTVLAKNTDNVKVVYGETTLSVSAKLPT
ASDYSLELDLAHHVVPDQCLYKVMPSKIEIKLKKRDGHRWTVLEGNPVSQDVQPIPQEIL
QAGTQPPKYPSSSKKSKDWDKVEKEIEKQEAEEKPEGEAALNSLFQQIYGKGSDEVRRAM
NKSFQESGGTVLSTNWNEVGQGTVERKPPDGMEWKNWDS
NT seq 660 nt   +upstreamnt  +downstreamnt
atggcggatgaaccagcaaaaaacgaggttcaagataatcaaatgcctgcgccaaaaata
aagcatgattggtatcaaactgagactcatgttattgttactgttttggcaaaaaatacg
gacaatgtgaaggtcgtttatggcgagacaacactgagtgtttctgcaaaattaccaacg
gctagcgattacagtttagaattagacttggcccaccacgttgtacctgatcaatgtttg
tataaagtaatgccatctaaaatagagattaaactcaagaagcgtgatggtcatagatgg
actgttctggaaggtaatccagtaagccaagatgtacaaccaattcctcaagaaatattg
caagctggaactcaacctcctaagtatccaagctcttccaaaaaatcaaaagactgggat
aaagtagaaaaagagattgaaaagcaagaagctgaagaaaagccggaaggagaagctgcc
ctgaattcactcttccaacaaatttatggaaaaggatcagatgaagttagacgtgccatg
aacaaatcatttcaagagtctggtggaactgtgttaagtaccaattggaatgaagtaggc
cagggaacggttgaaagaaaacccccagatggtatggaatggaagaactgggattcctaa

DBGET integrated database retrieval system