KEGG   Nasonia vitripennis (jewel wasp): 100114023
Entry
100114023         CDS       T01081                                 

Name
(RefSeq) probable cytochrome P450 6a13
  KO
K14999  cytochrome P450 family 6 [EC:1.14.-.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nvi00199]
    100114023
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-  Acting on paired donors, with incorporation or reduction of molecular oxygen
    1.14.-.-  
     100114023
Cytochrome P450 [BR:nvi00199]
 Cytochrome P450, animal type
  CYP6 family
   100114023
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100114023
NCBI-ProteinID: XP_001599214
NASONIABASE: NV16224
UniProt: A0A7M7QRA2
Position
1
AA seq 539 aa
MLSLIKDCLWEPLPIVLIMLGYALYAFLTSTFDYWLVRGVPYRKPTPLLGNFGDLLLFRK
SQPEGISEMYNWFGNERFFGVFRVRSPILIVRDPELIKCVCVKDFHVFCNRGIPVNSTKD
PLSGHLFNLEGKHWKSLRSKLTPAFSSGKLKNMFYLLVECSDDLTRLVERRLEMLENSSS
SSSSSFPDASIVEVRELAANFTIDVIGSCAFGIQINALSDEDSEFRKAARRLSKPSYKAT
LWRMLRTSMPKLYKLLGVQVIDPSVTKFFMDVVSQMVKERENKALKRHDFMDLLIELKNR
GTLELDNGNGLRAHNDEEVPVAEEIVLDENTIAAQAFVFFVAGYETSSNTIAFCLYELAV
NPEIQEKARRDIIDALDKRDSKLTYDAVQDMKYLDMVILETLRKYPPAPLLSRRCEYPYK
LPGSDVELSKGMRVVIPIYAIHHDPKHYPEPDKFRPERFGDEEKRARHPYTFLPFGEGPR
NCIGTRFALLQTKVGVITFLRKYQVEVCEKTDIPIKFSRRSLVTASETGVSLNISRLSE
NT seq 1620 nt   +upstreamnt  +downstreamnt
atgttgagcctgataaaggactgcctctgggagcctctgcccatagtgctgataatgctg
ggctacgcgctctacgccttcctgacctcgacgttcgactattggctggtccgcggggtg
ccttatcgcaagccgactccgctgctgggaaacttcggcgacctgctgctcttccgcaag
tcccagcccgagggcatcagcgagatgtacaactggttcggcaacgagcgcttcttcggc
gtcttccgcgtgcgctcgccgatcctcatcgtcagggatcccgagctcatcaagtgcgtc
tgcgtcaaggacttccacgtgttctgcaatcggggcatacctgtgaacagtacaaaggac
cccttgtccgggcatctgtttaatttggaaggaaagcactggaagagcctgcgctccaag
cttacaccagccttttcctcgggcaagctgaagaacatgttctacctgctggtggaatgt
tcggacgatctaacgcggctggtggaacgtcgtctcgagatgctcgagaacagcagcagc
agcagcagcagcagtttcccggacgcgtcgatcgtcgaggtgcgtgagctggctgcaaat
ttcacgatcgacgtgatcggcagctgcgccttcggcatacagataaacgccctcagcgac
gaggactcggagttccgcaaggcggccaggaggctctccaagcccagctacaaggccacc
ctctggcgcatgctcaggacctcgatgcccaagctctataagctgctgggggtccaggtg
atagatccgtcggtaacgaaattcttcatggacgtcgtttcgcaaatggtgaaggagagg
gagaacaaggctttgaagagacacgactttatggatcttctgattgaattgaaaaacaga
gggactcttgagcttgacaatggtaatgggctgcgagcccacaacgacgaggaggttcca
gtcgccgaggaaatagttctcgacgagaacacaatagcggcgcaggcctttgtcttcttc
gtggctggctacgagacgtcgtcgaatacgatagccttctgcctctacgagctcgcagtg
aatcccgaaatccaagaaaaagctagacgcgacataatcgacgcgctcgacaagcgcgat
agcaagttgacgtacgacgccgtgcaagacatgaagtacttggacatggtcatactggaa
acgttgaggaagtatccaccagcgccgttgctctcgcgacgatgcgagtatccgtacaag
ctgccgggcagtgacgtcgagctttccaagggtatgcgagtcgtcataccgatttacgcg
atacaccatgacccgaagcactatcccgagccggacaagttcaggcccgagagattcggc
gacgaggagaagagggccaggcatccctacactttcttgccgttcggcgaaggaccccgc
aactgcataggtacgagattcgcactattgcagaccaaagtcggagtgatcaccttcctg
aggaagtatcaagtggaggtatgcgagaaaacggacattccgataaagttcagcagacgg
agtctggttaccgccagcgaaaccggggtgagcctgaatatctcaagactgtcggaatga

DBGET integrated database retrieval system