KEGG   Nasonia vitripennis (jewel wasp): 100114055
Entry
100114055         CDS       T01081                                 

Name
(RefSeq) probable 26S proteasome non-ATPase regulatory subunit 3
  KO
K03033  26S proteasome regulatory subunit N3
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03050  Proteasome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    100114055
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:nvi03051]
    100114055
Proteasome [BR:nvi03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    non-ATPase subunits
     100114055
SSDB
Motif
Pfam: Rpn3_C PCI MIT CSN8_PSD8_EIF3K
Other DBs
NCBI-GeneID: 100114055
NCBI-ProteinID: XP_001605959
NASONIABASE: NV11103
UniProt: A0A7M7G7B9
Position
2
AA seq 497 aa
MGVQGKTVEAMEVEVSNPEAPNGEEAEKKDVDLITIHDLREHTRQIEKAVLNKEPRFILR
ALRALPNTRRKLNPIVLRGIIGGFYTKSAAEKEALLAWVEEPMDMEGTQAAIQRFKSSAT
PLLPEIDAYIHLLVLVRLIDTKKYTEAVQCSEALVQKIIAQNRRTIDLIAAKCYFYHSRA
YELTNQLDKIRGFLHLRLRTATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVLKSTFP
ETASNNEWARHLYYLGRIKSARLEYSDAHKHLVQAMRKAPQTTAVGFRQTVQKLAVTVEL
LLGDIPERQIFRQAALRRALAPYFQLTQAVRLGNLQRFGEVLENFGPQFRSDHTFTLILR
LRHNVIKTAIRSIGLSYSRISPADIARKLGLDSGVDAEFIVAKAIRDGVIEATLDPENGY
MRSKETTDIYCTREPLLAFHQRITFCLDLHNQSVKAMRYPPKSYGKDLESAEERREREQQ
DLELAKEMAEEDDDGFP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgggtgtccaaggaaaaactgtagaggctatggaggtcgaggtttcaaatccagaagct
cctaatggtgaagaagctgaaaagaaggatgttgatctcatcactatccatgatctgcga
gaacacacaagacagattgaaaaagctgtactcaacaaagagcccagatttattcttaga
gctttgagagctttaccaaatacaagacgcaagctgaatcccattgtcctccgtggtatc
attggtggattttacacaaaatcagcagcagaaaaagaagctcttttagcatgggttgaa
gagccaatggatatggaaggcacacaggctgccattcagaggtttaagagttcagctact
ccgctattgccagaaattgatgcttatattcatttacttgtgcttgtaagattaattgat
actaagaaatacactgaggcagttcagtgctctgaagctcttgttcagaagattattgct
caaaaccggagaaccattgatttgattgctgccaaatgttacttttatcattcaagagct
tatgaactaacaaatcagttggacaagattcgaggtttccttcatttgagattgcgtaca
gcaacacttcgcaatgactttgaaggccaagctgttctcattaactgtttgcttagaaat
tacttgcactacaatctctatgatcaagctgacaaattagttctgaagtcaacttttcca
gagactgctagcaataacgaatgggctcgtcatttgtattatttaggtagaatcaagtct
gcaagactagaatattctgatgcgcataagcatttggtacaggctatgcgtaaagcacca
caaacaacagcagttggttttagacagacagtccaaaagcttgctgtgactgttgaactt
ttattgggtgacataccagaaagacagattttcaggcaagcagctttgaggagagctctt
gctccatatttccaactcacgcaggctgtgagattaggaaatttacagcgctttggtgaa
gttttggaaaactttggacctcaattcagatcagatcacaccttcactttgattttgaga
ttgagacataatgtcatcaaaacagctattcgctctattggactgtcatactcgcgtatc
tctccagctgacattgctagaaaattaggattggattctggagtagatgcagaattcatt
gttgctaaggctattcgtgatggtgtaatagaagctacacttgatcctgaaaatggatat
atgcgaagcaaggaaacaacagacatctattgcactcgggaacctttgcttgctttccac
caaagaataaccttctgtttggacttgcacaaccagagtgtgaaagctatgagatatcca
ccaaaatcatatggcaaagatcttgaatcagcagaagagagaagagaaagggagcaacaa
gatttggaattggcaaaagaaatggctgaagaagatgatgatggtttcccttaa

DBGET integrated database retrieval system