KEGG   Nasonia vitripennis (jewel wasp): 100114558
Entry
100114558         CDS       T01081                                 
Name
(RefSeq) 60S ribosomal protein L27
  KO
K02901  large subunit ribosomal protein L27e
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100114558
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nvi03011]
    100114558
Ribosome [BR:nvi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100114558
SSDB
Motif
Pfam: Ribosomal_L27e KOW
Other DBs
NCBI-GeneID: 100114558
NCBI-ProteinID: XP_001599509
NASONIABASE: NV15854
UniProt: A0A7M7G4V9
Position
2
AA seq 134 aa
MVKIMKTGKVVLVLSGRYAGRKAIVMKNYDDGTTDKQYGHALVAGIDRYPRKVHKRMGKA
KIHKRSKIKPFVKILNYNHLMPTRYTVDLALEKVTPKELKDPMKRKKIRFQTRVKFEERY
KSGKNKWFFQKLRF
NT seq 405 nt   +upstreamnt  +downstreamnt
atggtgaagattatgaaaactgggaaagtcgtactggtccttagtggccggtacgcaggc
agaaaggctattgtcatgaaaaattatgatgatggcaccaccgacaaacagtatggtcat
gctttggtggctggtattgaccgttaccctcgcaaggttcacaagcgaatgggcaaggca
aagatccacaagcgttccaagataaagccctttgtcaagattttgaactacaaccacctg
atgccaaccagatacacagttgatctggccctggagaaggttacgccaaaagaattgaaa
gacccaatgaagaggaaaaagatcaggttccagactagagtgaaattcgaagagaggtac
aagtccggcaaaaacaagtggtttttccagaagcttcgattctaa

DBGET integrated database retrieval system