KEGG   Nasonia vitripennis (jewel wasp): 100114907Help
Entry
100114907         CDS       T01081                                 

Definition
(RefSeq) heat shock protein 68-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03040  Spliceosome
nvi04141  Protein processing in endoplasmic reticulum
nvi04144  Endocytosis
nvi04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100114907
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100114907
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100114907
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    100114907
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:nvi01009]
    100114907
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:nvi03041]
    100114907
   03009 Ribosome biogenesis [BR:nvi03009]
    100114907
   03110 Chaperones and folding catalysts [BR:nvi03110]
    100114907
   04131 Membrane trafficking [BR:nvi04131]
    100114907
   03051 Proteasome [BR:nvi03051]
    100114907
   03029 Mitochondrial biogenesis [BR:nvi03029]
    100114907
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100114907
Protein phosphatases and associated proteins [BR:nvi01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     100114907
Spliceosome [BR:nvi03041]
 Complex B
  Other components
   Prp19 complex
    100114907
 Complex C
   Prp19-CDC5 complex
    100114907
Ribosome biogenesis [BR:nvi03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    100114907
Chaperones and folding catalysts [BR:nvi03110]
 Heat shock proteins
  HSP70 / DNAK
   100114907
Membrane trafficking [BR:nvi04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    100114907
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    100114907
Proteasome [BR:nvi03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    100114907
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    100114907
Exosome [BR:nvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100114907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl Hydantoinase_A StbA
Motif
Other DBs
NCBI-GeneID: 100114907
NCBI-ProteinID: XP_001599773
NASONIABASE: NV11002
Position
2
AA seq 662 aa AA seqDB search
MKNDQANNFDSEKVNRNTYNKMPAIGIDLGTTYSCVGVWQQGKVEIIANDQGNRTTPSYV
TFTDTERLIGDAAKNQVAMNPANTVFDAKRLIGRRFDDEKIQNDIKHWPFKVVNEGGKPK
IEVEFRGEKKRFNPEEISSMVLTKMKETAEAFLGQKVKDAVVTVPAYFNDSQRQATKDAG
AIAGLNVLRIINEPTAAALAYGLDKNLKGEKNVLIFDLGGGTFDVSILTIDEGSLFEVKA
TAGDTHLGGEDFDSRLVDHLCKEFERKYKKNIKSNPRALRRLRTAAERAKRTLSSSTEAS
IEIDALFEGIDFYTKVSRARFEELCADLFRSTLEPVEKALADAKLDKRSIHDVVLVGGST
RIPKIQSMLQNFFCGKQLNLSINPDEAVAYGAAVQAAILTGEGGKNSTLQDVLLVDVAPL
SLGIETAGGVMTNIIERNARIPCKQSQTFTTYSDNQPAVTIQVFEGERAMTKDNNHLGRF
ELSGIAPAPRGVPKIDVTFDMDANGILHVTAKDTASGRSNNIRITNDKGRLSREEIDRML
ADAERYRSQDAEQREKVSARNQIESYVFSVKQAVQDSGDKLTQSDKDSVLSLCDETIRWL
DNNTLAEKDEYKHKLEDLQKQCAPIMTKIHTGGASGPQDCGNQFRQGEGSNNYSGPTVEE
VD
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgatcaagcgaataacttcgatagtgagaaagtaaaccgaaacacatacaac
aaaatgcctgcaattggtattgacttgggaaccacctactcctgcgttggagtttggcaa
cagggaaaggtggaaatcatcgccaacgaccagggcaacaggacgacacccagctatgtt
accttcacggacacggagcgcctcatcggcgacgctgctaagaaccaggtggcgatgaac
cccgctaacacagtcttcgacgccaagaggcttatcggcagaaggttcgacgacgagaag
atccaaaacgacatcaaacactggcccttcaaagtcgtcaacgaaggcggtaagcccaag
atcgaggtcgagttccgcggcgagaagaagaggttcaatccggaggagatcagctcgatg
gtcctgacaaaaatgaaggaaacagccgaagcgtttttgggccagaaggtgaaagacgcg
gttgtcacagtgcccgcgtactttaacgactcgcagcgtcaggccaccaaagatgctgga
gcgatcgccggtctcaacgttctcaggatcatcaacgagccgacagccgcggcgctcgcc
tacggtctcgacaaaaatctcaaaggcgagaagaacgttctcatcttcgatcttggcgga
ggtaccttcgacgtgtccatcctgaccatcgacgaagggtctctcttcgaggtgaaagcc
acggcgggagacactcatctcggaggcgaagatttcgactcgagacttgttgaccacctc
tgcaaagaatttgagaggaaatacaagaagaacatcaaatctaatccaagggccctccga
cgtctgagaacagcggcagaacgtgccaagcgtaccctgtcttccagcacggaggcttcg
attgagattgatgcactctttgagggcattgatttctacaccaaggtctctagggcgcgc
ttcgaggagctctgcgctgacctgttccgctccactctcgaaccagtggagaaggccttg
gctgacgccaagttggataagcgatcgatccatgacgtcgtcctcgtaggaggttcaact
cgaatcccgaagatccagtcaatgctgcagaacttcttctgtggcaagcagttgaacttg
tccatcaatcccgacgaggcagtcgcctacggcgcagcagtgcaagcagctattctgacc
ggcgagggcggcaagaactcaaccctccaagacgttctgctggtagacgttgcacctctg
tccctcggcatcgagaccgccggaggagtcatgaccaacatcatcgagcgcaacgcccgc
attccatgcaaacagtcgcagaccttcactacgtactcggataaccaaccggctgttacc
atccaagtgttcgagggtgagcgtgccatgaccaaggacaacaaccatcttggtcgcttc
gaactcagcggtatcgcaccggcgccccgtggcgtgccaaagatcgatgtcaccttcgac
atggatgccaacggtatcctgcacgtcactgccaaagacactgccagcggtcgcagcaac
aacattcgcatcaccaacgacaagggacgcctgtcgcgggaggaaatcgacaggatgctg
gcagacgccgagcgataccgctcgcaggacgcagagcagcgcgagaaggtctctgcccgc
aaccagatcgagagctacgtgttctcggttaaacaagcagtccaggacagcggcgacaaa
ctcacgcaatccgacaaggatagcgtgctgagcttgtgcgacgagaccatccgctggctc
gacaacaacaccttggccgagaaggatgagtacaaacacaaactggaggacctgcagaaa
cagtgtgcgccgatcatgaccaagatccacaccggaggtgcatctggaccccaggattgc
gggaatcaattcagacagggtgaagggagtaataactactccggtccaacagttgaagaa
gttgattaa

DBGET integrated database retrieval system