KEGG   Nasonia vitripennis (jewel wasp): 100115053
Entry
100115053         CDS       T01081                                 
Name
(RefSeq) RNA-binding protein 8A
  KO
K12876  RNA-binding protein 8A
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03013  Nucleocytoplasmic transport
nvi03015  mRNA surveillance pathway
nvi03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    100115053
  09122 Translation
   03013 Nucleocytoplasmic transport
    100115053
   03015 mRNA surveillance pathway
    100115053
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:nvi03019]
    100115053
   03041 Spliceosome [BR:nvi03041]
    100115053
Messenger RNA biogenesis [BR:nvi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     100115053
Spliceosome [BR:nvi03041]
 Complex C
  Other components
   EJC/TREX
    100115053
SSDB
Motif
Pfam: RRM_1 RRM_3
Other DBs
NCBI-GeneID: 100115053
NCBI-ProteinID: XP_001604863
NASONIABASE: NV15939
UniProt: A0A7M7LM79
Position
2
AA seq 165 aa
MADVLDIDNAEEFEVDEEGDQGIARLKEKAKKRKGRGHGAELVSTRDDVGHYESMHVVED
DNEPGPQRSVEGWILFITSVHEEAQEDDIHDKFSEFGQIKNLHLNLDRRTGFLKGYALVE
YETFKEAQAAKDALNGSEILGQAVGVDWCFVKGPKKLKKRSGRRR
NT seq 498 nt   +upstreamnt  +downstreamnt
atggctgatgttctggatattgacaatgcggaagagttcgaggtcgatgaagaaggagac
cagggaatcgcaagactaaaggagaaggcgaagaagaggaaaggacgtggacatggagca
gagcttgtttccacaagagacgatgttggtcattatgagtccatgcatgtagttgaagat
gataatgaacctggcccacaaagatctgtagaaggctggattttattcatcacatccgtc
catgaagaagctcaggaagatgatattcacgacaagttttccgaatttggccagatcaaa
aatttgcatctcaatttggacagaaggacaggctttttgaaaggctatgcacttgtagaa
tatgaaacctttaaagaagcacaagctgctaaggatgcgttaaacggatcagaaattctt
ggccaagcagtaggagttgactggtgtttcgttaagggaccaaagaaattaaaaaagagg
agtggcagaaggcgatag

DBGET integrated database retrieval system