KEGG   Nasonia vitripennis (jewel wasp): 100115275
Entry
100115275         CDS       T01081                                 

Name
(RefSeq) 14-3-3 protein zeta isoform X1
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04013  MAPK signaling pathway - fly
nvi04391  Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04013 MAPK signaling pathway - fly
    100115275
   04391 Hippo signaling pathway - fly
    100115275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:nvi03400]
    100115275
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100115275
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    100115275
Exosome [BR:nvi04147]
 Exosomal proteins
  Proteins found in most exosomes
   100115275
SSDB
Motif
Pfam: 14-3-3 PhoU_div
Other DBs
NCBI-GeneID: 100115275
NCBI-ProteinID: XP_031777058
NASONIABASE: NV12082
Position
1
AA seq 247 aa
MSVDKEELVQRAKLAEQAERYDDMAAAMKSVTETGVELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTEGSERKQQMAKEYREKVEKELREICYDVLGLLDKYLIPKASNAESKVFY
LKMKGDYFRYLAEVATGETRNAVVEDSQKAYQDAFEISKAKMQPTHPIRLGLALNFSVFY
YEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDTQGDGDE
PQEGADN
NT seq 744 nt   +upstreamnt  +downstreamnt
atgtccgtggacaaagaagaattagtgcagcgcgctaagctggccgagcaggccgagagg
tacgatgatatggcggcggcaatgaagtccgtcaccgaaaccggcgtcgagctctcgaac
gaggaaaggaacctcctgtccgtcgcctacaagaacgtcgttggggcgaggcgcagctcg
tggcgagtcatctcctcgatcgagcagaagaccgagggctccgaacgcaaacagcaaatg
gccaaggaataccgggaaaaagtcgaaaaagagctgcgcgaaatctgctacgacgttctg
ggactccttgacaagtacctgatccccaaggctagtaatgcagaaagcaaagtattctac
ctcaagatgaagggtgattacttcaggtatctcgcggaagtggctacgggtgaaaccagg
aatgccgtggtagaagacagccagaaagcgtaccaggatgcgttcgagatcagcaaggcc
aagatgcagccgactcatccgataaggctaggtctcgcactcaacttctccgtcttctat
tacgagatcctcaactcgccggacaaagcctgccaattggccaaacaggcgtttgacgat
gcgatcgccgagctcgacacactcaacgaggacagctacaaggattcgacgctgatcatg
caactgttgcgagacaacctcaccctctggaccagtgacacacagggcgacggagacgaa
ccacaagagggtgccgacaactaa

DBGET integrated database retrieval system