KEGG   Nasonia vitripennis (jewel wasp): 100115387Help
Entry
100115387         CDS       T01081                                 

Definition
(RefSeq) protein disulfide-isomerase A3
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100115387
Enzymes [BR:nvi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100115387
Chaperones and folding catalysts [BR:nvi03110]
 Protein folding catalysts
  Protein disulfide isomerase
   100115387
Membrane trafficking [BR:nvi04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    100115387
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100115387
  Exosomal proteins of colorectal cancer cells
   100115387
  Exosomal proteins of bladder cancer cells
   100115387
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 Thioredoxin_8 AhpC-TSA Redoxin Glutaredoxin Calsequestrin TraF OST3_OST6
Motif
Other DBs
NCBI-GeneID: 100115387
NCBI-ProteinID: XP_001599732
NASONIABASE: NV17633
UniProt: K7J8B8
Position
3
AA seq 498 aa AA seqDB search
MVGKYLALFGLALVASTGTWAAEEDVFEWGDGDFAEELRRHDNTLVMFYAPWCGHCKRLK
PEYAKAAELLRGSDPPITLAKVDCTEAGKDTCNKYSVSGYPTLKIFAKDELVNDYNGPRE
AAGIAKYMRGQVGPASKELKTLAAFEEFLNSDEISVVGFFEKDDSPLSAAFHNVAKKLRE
KVRFGHTIAKEVLEKEGLENNIVIFRPKVLQNKFEPSKQVYEGGDSISEVSAFIKQNYYG
LVGVRTRDNAGEFKNPLIVAYYAVDYVKNPKGTNYWRNRIMKVAKDFAKEYDYTFAISSK
DEFQHELNEFGIDFVKGDKPVILARDERNQKFALQEEFSLEAFEIFLNDLQAGSLEPYQK
SEPIPEDNSGSVKVAVAKNFDEVVTNNGKDTLIEFYAPWCGHCKKLALIFDELGDKLVDE
DVEIVKFDATANDVPQPYEVRGFPTLFWVPKDSKDSPVKYEGGRDLDDFVKYIAKHATNP
LKGYDRSGKPTKAPQDEL
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtaggcaagtacctggcgctcttcggcctcgcgctcgtcgcgagcaccggcacctgg
gccgccgaggaggacgtcttcgaatggggcgacggcgactttgccgaggagctccggcgc
catgataacacgctcgtcatgttctacgcgccctggtgcggacactgcaaacgcctgaag
cccgagtacgccaaggccgccgaactgctgaggggcagcgatccgcccatcaccctggcc
aaggtcgactgtacggaagctggcaaggacacgtgcaacaagtactccgtcagtggctac
ccgactctcaagatcttcgccaaagacgagctggtcaacgactacaatggaccaagggag
gctgccggtattgccaagtacatgaggggtcaagttggaccagcctcgaaggagctcaag
actcttgctgccttcgaagaattcttgaacagcgatgaaatcagcgttgttggattcttc
gagaaggatgactccccgctgtctgctgccttccacaacgttgctaagaagctcagagag
aaggtcagatttggacacactatcgccaaggaagttcttgaaaaggaaggactcgagaac
aacatcgtcattttccggcctaaagttctacaaaataaatttgagcctagcaaacaggtt
tacgaaggcggagattccatctcggaagtcagcgcgttcatcaaacaaaactactacggt
ctcgttggcgttcgtacgcgtgacaacgctggcgagttcaagaaccccctgatcgtcgcc
tactacgccgttgactatgttaagaatccaaagggcaccaactactggcgcaaccgcatc
atgaaggtggccaaggacttcgcgaaggaatacgactacacgtttgccatctcgtccaag
gatgagttccaacacgaactcaacgagtttggcatcgacttcgtcaagggcgacaagccc
gtcattctcgctcgcgacgagcgcaaccagaagttcgctctccaagaagagttcagtctt
gaggcctttgaaatcttcctcaacgacttgcaggctggatctcttgagccctaccagaaa
tctgagcctattcccgaggacaactctggtagcgtcaaagtagcagttgccaagaacttc
gacgaggtcgtgacgaacaatggcaaggacacgcttatcgagttctacgctccatggtgt
ggacactgcaaaaaacttgctctcatcttcgatgaattgggtgacaagctcgtcgatgag
gacgtagagatcgtcaagttcgacgcgaccgccaacgacgttccgcagccctacgaggtt
cgcggtttccctacgctgttctgggtgccaaaggattcgaaggatagtccagttaagtac
gagggtggccgagatcttgacgattttgtcaagtacattgccaagcacgctaccaatcct
ctgaagggatacgatcgcagcggaaaaccgaccaaggccccacaagacgagctgtaa

DBGET integrated database retrieval system