KEGG   Nasonia vitripennis (jewel wasp): 100115712
Entry
100115712         CDS       T01081                                 

Definition
(RefSeq) zinc finger protein 277 isoform X2
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: zf-C2H2_2 zf-C2H2_4 DUF3861
Other DBs
NCBI-GeneID: 100115712
NCBI-ProteinID: XP_001600354
NASONIABASE: NV15405
Position
4
AA seq 409 aa
MSNLEAHAQAKDVKISTNLQNYASTCKSQFNDLDDKPCDLPCLLCDTSFTLPTKEQDFLT
HLFNEHRLVIGDVKKIASLKSYIRYWRVKFKEQPLTTFCTTLTAEKKDSASADSIPGTDD
FYFLLSDCLMEDKTLRDELRRAKLEWVLAEQVKERSDSTFKRGCMFCREEFEGSRIEYLK
HLCQKHNIFLGKPENLVFIDEYLDKIQSNIERFLCIYCEKKFKNRVVLKEHMRKKTHKQV
NPNNKNYDKYYVTNYINEPSNNNKRYKSYTAESEDPSGFTDNEEEDWSDWTNECISTTCL
FCKESTQDFAQILEHMKSKHKFNFEDETKEFTFYQKVKIVNYIRKQIYINKCVYCDESKE
DLSVHMDQENHCKLPQKRIWDQPEFFFPMFESDSFLYNLDTDSDTEETT
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgtctaatttagaagcacatgcacaagcaaaagatgtcaaaatttcaacaaatttacaa
aattacgcttcaacttgcaaatcacagtttaatgatcttgatgacaaaccctgcgatttg
ccttgcttactttgtgacaccagttttacacttcctacaaaggaacaagattttcttacg
catttgttcaatgaacatcgtcttgttattggagatgtaaaaaaaatagcaagtttaaaa
agttacattcgttattggagagtcaaattcaaagagcagccattaactactttttgtact
acgttgacagcagaaaaaaaggattcagcatctgcagattctatacccgggacagatgat
ttttactttttactctcagattgtctaatggaagacaaaactctccgggatgaattgcgt
agagctaaattagaatgggtactagcagaacaagtaaaagagagatcagattcaacattt
aaaagaggatgcatgttctgtcgagaagaatttgaaggttcacgaattgaatatttgaaa
catctttgtcagaagcataatatttttcttggaaagcctgaaaatttagtttttattgat
gagtaccttgataaaatacaaagtaatatagaaaggtttttatgtatatattgcgaaaaa
aagtttaaaaatcgtgtagtattaaaagaacacatgcgaaaaaaaacacataaacaagta
aatcctaataataaaaactatgataaatattatgtcaccaattatataaacgaaccatca
aataacaacaaacggtacaaatcatacactgcagaatcagaagatccttctggatttact
gacaatgaagaggaggattggtcagattggaccaatgaatgtatatctacaacatgttta
ttttgcaaagaaagcactcaggattttgctcaaattttggaacacatgaaatcaaagcat
aaatttaactttgaagatgaaaccaaagaatttacattttatcaaaaggtaaaaatagta
aattatataagaaagcaaatatacataaataaatgtgtttactgtgatgaaagcaaagag
gatcttagtgttcatatggatcaagaaaatcattgtaaattgccacaaaaacggatatgg
gatcagccagaatttttttttccaatgtttgagagtgattcttttttatacaacttagat
actgatagtgacactgaggaaacaacttga

DBGET integrated database retrieval system