KEGG   Nasonia vitripennis (jewel wasp): 100115760
Entry
100115760         CDS       T01081                                 

Definition
(RefSeq) AF4/FMR2 family member 4
  KO
K15195  AF4/FMR2 family member 3
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nvi03021]
    100115760
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     100115760
SSDB
Motif
Pfam: AF-4_C AF-4
Other DBs
NCBI-GeneID: 100115760
NCBI-ProteinID: XP_016836560
NASONIABASE: NV16256
Position
1
AA seq 1503 aa
MERGRTKPSSTGYYDDRNPLLKGTLSSVDRDRLREKERQARAAMSVQAEQAAARGAPDTR
HGHHHHGHHNHGHHHVEPYPATDSLFRAPVKVNPDAHDSTTKQIQSKLGNYSLVKHLLVD
EPKRLFGIEGVPASPAPVSSNHSRMPSSRSSPSTGGGANSGTGSSQEFKKPGGSGPRSSS
STSVATSSSSSSTSSSSQRGGFVKPADSKPPHGGRGGYPGQPVKHGSSSNEHRSHGLIPA
KGPPPGSSSSSSSVGMAGSNSGAAGQSSSGLMGGSSASMQRQMHTASVRLPKLSFDGVSS
KFSTPELEHILKEMTQPPTPLTAIAQTPRKELESKFTFNPLLAKLTEVVPEPAKPQRERS
RLSTDLAQDLNLSEDSEEDEAPSTGPPRPIKDGRSPMSVDLTAPLISAMSSVQPPLVPMS
PLPMSPDGALSLIRPLSPPPQPMQQQQQLQAPAMPQPIQHTTSHHSPMVLSAAKPSPQPQ
QQQLPVRRADSPDEEPSKSSHQRPPSPPGEAPASSGSASSSSDSGSDSGSDSSDDSEDEP
NTSTTQPAVKGPTTPPSASPHEVPKEPPPPAEESKPRWNLSSFFSKAAEPPQQQPPEQTK
KKDEATPRQAQTQAQSQPERRSSRHSQHHDWELERNRNATQLSSLSDSEQQSDVEKAQVK
EPPRAQAQAEKPKPPDVRKRGRPRKTDKSPKPAASVPEEPKVPAKRSRQRSRQTSTSSPT
RRNKKQPLSKETLTTTTTTSSDDGSDGGHRYSDSDSDPLAQVKLPPPAPPSHSRRTQPSA
ADKKRHRSRLSESTSEEEDDNDDDDDERPHRRGKRSQDEDSRWSRLPSVKRNSKLSESPK
KVQEKKKSPPKLKPRRQRSRVASAPECPSESDSESEVALRTNRKVARVQPRPRVPPTRTT
SPDNSDSDNSPASVKLQDETGATVQDNKKSALRRLFVDSRAKGGKGGKGGKGGKGGAKCG
IYVEEYTGNTPTGSESPYKRPAPVMAPDRQEEKRSEEKRQQVSFPPLSFVNGVPKLMCKL
DLNKLGHIPQLSRGQEIRQRTEMPDTRPSSRQQSNSRTSQRPSTPEEGEIVESRSHASGA
NAAEDSDSAAAAVTPKGGSSRSSSSGNSRVIKSDTADAKSSDAKPIPSASDSNSAGGSGG
SGGARGHVNSATTGSGVKRKRKESCSSVSSLSTVSSGDTKVKSDIKEDRKKRKRKHQEQE
NVARFPSSQQSDAQPTNHEREEKPDMSLLPPPPQRFYSYFYIQSDAMEDLDSYQEQYLQE
AKRLKHLADEERDVTTQGLLYLEGAIYFLLTGQAMESSRSIGTAYRMYKDTLSIIKFIAN
KFQSTVSSNSSSNTVESTIHTRLLTLSLWCQSLIYQKLFAMRKSEIKGNYIFLEEYFAKP
EGQGTPSLSPTPSPAGSVGSVGSQSSGYSSGELANRGLANGQAPSSYLSVPSQVHAAMAR
QHHDLGLLINAHDKWDKARDLVTDRHRDFFIELDETLGPLTPKSSLTDLARYVQAGIKKL
RTL
NT seq 4512 nt   +upstreamnt  +downstreamnt
atggagagagggagaacgaagccgtcctccactggctactatgacgacaggaatccgctc
ctcaagggcactctatccagtgtggacagggaccggcttcgcgaaaaggaacgacaggcc
cgggcggctatgtcggtccaagcggagcaggcagcggcccgaggtgcgccggatacaagg
catggccaccatcaccacggtcatcacaaccacggccaccaccacgttgagccgtatccc
gccaccgactcgctcttccgcgctcccgtcaaggtgaacccggacgcccacgacagcacg
accaagcagatccagtcgaagctgggcaactactcgctggtcaagcacctgctggtggac
gagccgaagcggctgttcggcatcgagggcgtgccggcctcgccggcgccggtcagttcg
aaccacagccggatgccctcgtcgcggagctcgccctcgaccggaggcggcgccaacagc
ggcaccggctcgtcgcaggagttcaagaagcccggcggcagcggaccgcgctcatcttcc
tcgacgtccgtcgcgacgtcctcgtcctcctcctcgacgtcctcgtcgtcgcagcgcggc
ggattcgtcaagcccgccgacagcaagcctccgcacggaggcaggggaggctaccccgga
cagcccgtgaagcacgggagcagcagcaacgagcaccgcagccatggactgataccggcc
aaaggcccacctcccggatcgtcttcttcttcttcctcggtaggcatggccggcagcaat
agcggagccgctggacaatcgtcgtcgggtctcatgggaggcagcagcgctagtatgcag
agacagatgcataccgccagtgtcagactgcccaagctgagcttcgacggtgtgagttcc
aagttcagcacgcccgagctcgagcacatcctaaaggaaatgacccagccgccaacgcct
ctgaccgcgatagctcagacgcccaggaaagagctggagtccaagttcaccttcaacccc
cttctcgccaagctaacggaagtcgttccggaaccagcgaagcctcagcgtgagaggtcg
aggctgtctactgacctggcgcaagatctaaacctctccgaggacagcgaagaagatgag
gctccaagcacagggcccccgaggccgataaaggatggccggagtcctatgtcagtagat
ctgacagcgccgttgatttcggcgatgtcatcggtgcaaccgccactggtcccgatgtcc
cctctgcccatgtccccggacggagcgttgtcgttgataaggccgctctcgccaccgcct
cagcctatgcaacagcagcagcagctccaggccccggcgatgccgcagcctatccagcac
acgacgtcccatcactcgccgatggtcctctcggcagccaaaccctcgcctcagccacag
cagcagcaactgccggttaggagggctgacagccctgacgaggagccgtctaaaagctcg
caccaaagaccgcccagtccgcctggcgaagcgccagctagttcggggagcgcctcgtcc
tcgtcggactcgggctcggactcgggctccgacagcagcgacgactcggaagacgaaccc
aacaccagcacgacgcagccggccgtcaaaggtccaaccacgccgccctctgcgtcgccc
catgaggttccgaaagagcccccacccccggccgaggagtcaaaaccacgctggaacctg
tcctcattcttcagcaaggcggctgagccgccgcaacagcaacccccggaacagacaaag
aagaaggacgaggccacgcccaggcaggcccagacgcaggctcagagccagccggagcga
cgctcttcccgacactcgcagcatcacgactgggaactcgagaggaacaggaacgcgacg
cagctgagcagcctcagcgacagcgaacagcagagcgacgtcgagaaggcgcaggttaag
gagccccccagggcccaggcgcaggcagaaaaaccaaagcccccggatgtccgcaagcgc
ggcagacctcgtaaaacggataaaagcccgaaaccggcggcgtccgtacctgaagaaccg
aaagtcccagccaaacgcagtcgtcagcgcagtagacaaacgtcgacgagcagtccgacc
cgacgcaacaagaagcagccgctgtcgaaggagaccctgacgacgacgacgacgacatcg
agtgacgatggcagcgacggcggtcaccgttactccgactctgactcggacccactggct
caggtcaagttaccacccccggcaccaccaagtcacagcaggaggacacagccatcggcg
gctgataagaaacgccacagatccaggctcagtgaatctaccagtgaagaagaggacgat
aacgatgatgatgatgacgagaggccgcatcggcgcggaaagagatcgcaggacgaggat
tcccgctggagcaggttaccctcggtgaaaagaaatagcaaactgagcgaatcgccaaag
aaggtacaagagaagaagaaaagcccgccgaaactcaaacctagaaggcagcggtcccga
gttgccagtgctcccgagtgtccctcggaatcggacagcgagtctgaggtggccttaagg
accaatcggaaggttgcacgagttcagccaaggcctcgagttccgccaacgcgcacgacg
tcacccgacaattcggacagtgacaacagcccagcttcggtaaaactccaggacgagacc
ggagccacggttcaggacaacaagaagagcgccttgcgtcgtctgtttgttgattctcgc
gccaagggcggcaaagggggcaaaggaggcaaaggaggcaaaggtggcgccaagtgcggc
atctacgtggaagagtatacgggtaatacgccaacaggcagcgagagcccatacaaacga
cctgcgccagtcatggcgcctgacaggcaagaggagaagcgctcagaggagaagaggcag
caggtaagcttcccaccactgagcttcgttaacggagttccgaagctcatgtgtaagctt
gacctgaacaaacttggacatataccccagttgtccaggggacaagaaatcagacagaga
actgagatgccagataccaggccgtcttcaagacaacaatcgaactcacgtacatcacag
aggccttcgacgccggaggagggtgagatcgtcgagtcccggagtcacgccagcggcgca
aatgccgccgaggacagcgactcggcggccgccgcggtgacaccaaagggcggcagctcc
cgaagcagcagtagtgggaatagccgagtgatcaaaagtgatactgcggacgctaaatcg
agcgacgcgaagccgataccgagtgcaagtgacagtaatagtgccggcggtagtggtggt
agtggtggtgctagaggtcatgtgaactcggcgactactggtagtggtgttaagaggaaa
cgcaaagagagctgcagctctgtatccagtcttagtactgtttcctcgggtgacacaaag
gtcaagagcgatatcaaggaggacaggaaaaagcggaagaggaagcatcaggaacaggag
aatgtcgccaggttcccttcgagtcagcagagtgacgcacagcccacgaatcacgagcgg
gaagagaagcctgacatgagtctgctgcctccgccgccgcaacgcttctattcctacttt
tacatacaaagcgatgctatggaggacctagacagctaccaggagcagtacttgcaagag
gcgaagcgactgaagcatcttgccgacgaggagagggacgttacgacgcagggtttactg
taccttgagggtgctatatacttcctgctcaccggccaggctatggagtcgtcacgctcc
ataggtacagcctatagaatgtacaaagatactctttcaatcatcaaattcatcgcgaat
aagttccagtctacggtatctagtaactcatctagtaacacagttgaaagtaccattcac
acaagactgcttactttgagtttatggtgccaatcccttatataccagaagctattcgcc
atgagaaagagcgagattaaggggaattatatattcttggaggaatattttgcaaagcct
gaaggccagggcacaccgtccctgtcgccgacgccgtcacccgcgggatcggtcggatca
gtcggtagtcaaagcagcggctacagcagtggtgagcttgccaaccgcggactagctaat
ggtcaggcaccgtctagctatcttagtgtaccctcacaagtacacgccgccatggctagg
cagcaccatgacttagggctgctcatcaatgcccacgacaagtgggataaagccagggac
cttgttaccgacaggcacagagattttttcatcgagctggacgagacgttgggacccttg
acgccgaagagttcgctgacggatctggcgcgttacgtgcaggccggcattaagaagctg
cgcactctttga

DBGET integrated database retrieval system