KEGG   Nasonia vitripennis (jewel wasp): 100115771
Entry
100115771         CDS       T01081                                 

Definition
(RefSeq) DNA-directed RNA polymerase II subunit Rpb4 isoform X1
  KO
K03012  DNA-directed RNA polymerase II subunit RPB4
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    100115771
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:nvi03021]
    100115771
   03400 DNA repair and recombination proteins [BR:nvi03400]
    100115771
Transcription machinery [BR:nvi03021]
 Eukaryotic type
  RNA polymerase II system
   RNA polymerase II
    Pol II specific subunits
     100115771
DNA repair and recombination proteins [BR:nvi03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TCR (transcription coupled repair) factors
     DNA-directed RNA polymerase II complex
      100115771
SSDB
Motif
Pfam: RNA_pol_Rpb4 Tfb4
Other DBs
NCBI-GeneID: 100115771
NCBI-ProteinID: XP_008214078
NASONIABASE: NV18984
UniProt: K7JC40
Position
1
AA seq 138 aa
MANMNLDTIEEDAADLQFPKEFENADTLLISEVHMLLEHRKAQNESAEEEQEFSEVFMKS
LTYTNRFRKFKNKETIAAVRNLLSQKKLHKFELASIANLCPETPEEAKALIPSLEGRLED
EELRTILDDIQTKRSLQY
NT seq 417 nt   +upstreamnt  +downstreamnt
atggctaatatgaatttagatactattgaagaggatgcagctgacttgcaatttccgaaa
gagtttgaaaatgcagatacattattaatctcagaagttcacatgcttcttgaacatcgc
aaagctcagaatgaatcagctgaagaagagcaggaattttctgaagtctttatgaaaagc
cttacttatacaaatcgttttcgaaaatttaaaaacaaagaaactattgcagctgttcga
aatttattgagccagaaaaaattacacaaatttgaacttgcatcaattgctaatctttgt
cctgaaacaccagaagaagcaaaagcattaataccaagtttggaaggacgattagaagat
gaagaattaaggacaattttggatgatattcaaacaaaaaggtcgcttcagtattaa

DBGET integrated database retrieval system