KEGG   Nasonia vitripennis (jewel wasp): 100115795
Entry
100115795         CDS       T01081                                 
Name
(RefSeq) 60S ribosomal protein L32
  KO
K02912  large subunit ribosomal protein L32e
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03010  Ribosome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    100115795
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:nvi03011]
    100115795
Ribosome [BR:nvi03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    100115795
  Archaea
    100115795
SSDB
Motif
Pfam: Ribosomal_L32e
Other DBs
NCBI-GeneID: 100115795
NCBI-ProteinID: XP_001601522
NASONIABASE: NV15384
UniProt: K7J204
Position
1
AA seq 134 aa
MSIRPVYRPKIVKKRTKKFIRHQSDRYDKLKRNWRKPKGIDNRVRRRFKGQYLMPNIGYG
SNQKTRHMLPTGFRKVLVHNVKELEVLMMQNRKFCAEIAHGVSSKKRKTIVERAQQLSIR
VTNANARLRSEENE
NT seq 405 nt   +upstreamnt  +downstreamnt
atgtcgatccgaccagtgtacaggccgaaaatcgtcaagaagaggacgaagaagttcatc
aggcatcaaagtgaccgatatgacaagctcaagcgtaactggaggaagcccaagggtatc
gacaacagagtacgaaggcgtttcaagggacaataccttatgcccaacatcggttatggt
agcaaccagaagacccgtcacatgcttccaactggcttccgcaaagtccttgttcacaac
gttaaggaattggaagttctgatgatgcagaaccgtaaattctgcgcagaaattgcccat
ggagttagcagcaagaagcgtaagacgatcgtcgaacgtgcccagcagttgtctatccgt
gtgacgaatgccaacgctcgtcttcgttctgaggagaatgaataa

DBGET integrated database retrieval system