KEGG   Nasonia vitripennis (jewel wasp): 100116064
Entry
100116064         CDS       T01081                                 
Name
(RefSeq) probable phosphoserine aminotransferase
  KO
K00831  phosphoserine aminotransferase [EC:2.6.1.52]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00260  Glycine, serine and threonine metabolism
nvi00270  Cysteine and methionine metabolism
nvi00750  Vitamin B6 metabolism
nvi01100  Metabolic pathways
nvi01200  Carbon metabolism
nvi01230  Biosynthesis of amino acids
nvi01240  Biosynthesis of cofactors
Module
nvi_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100116064
   00270 Cysteine and methionine metabolism
    100116064
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100116064
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nvi01007]
    100116064
Enzymes [BR:nvi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.52  phosphoserine transaminase
     100116064
Amino acid related enzymes [BR:nvi01007]
 Aminotransferase (transaminase)
  Class V
   100116064
SSDB
Motif
Pfam: Aminotran_5
Other DBs
NCBI-GeneID: 100116064
NCBI-ProteinID: XP_001600620
NASONIABASE: NV15415
UniProt: A0A7M7LLB6
Position
4
AA seq 366 aa
MSEKNVERAINFGAGPAQLPLEVLKDVQEELLNYANTKVSILEISHRSNDFKKVVENAQA
RLSELLKIPDNYKVMFLQGGGTGLFAAVPLNMMKTGSADYIVTGAWSSKAAKEAAKYGKV
NLVLPKTTKYTEIPDKSTWNLDPNASYVYYCDNETVHGIEFHDIPDTKGVPLVADMSSNF
VSKPLDISKFALIYAGAQKNVGPSGVTIVIVRKDFIGTAMSICPSIFDFAVVAAENSIHN
TPPVFQIYFVGRVFEWIKKNGRVEGMAELAHKKSKLIYDVIEQSNGFYICPIDKKCRSRM
NIPFRIKNDEALENAFVAGAAALNMLQLKGHRSVGGIRASLYNAVTLEQVEALAKYMKAF
YQKHAN
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcgagaaaaacgtggaaagagccatcaattttggtgctggtcccgcacaacttcca
ctcgaggtactgaaagatgttcaagaagaattattgaactatgcaaatacaaaagtaagc
atacttgaaatcagtcatcgatctaacgatttcaaaaaggtcgtcgaaaatgctcaagca
agattgagtgaactgcttaaaattccagacaattataaagtcatgttcttgcaaggtggt
ggaactggtctttttgctgctgtgcccctcaacatgatgaaaactggaagtgcagattat
attgttactggtgcatggtcatctaaagcagccaaagaagctgctaaatatggaaaagtt
aatttggttttacccaaaaccactaaatatactgagattcctgataaatcgacttggaat
cttgatccaaatgcatcatacgtttattattgtgataatgaaacggttcatggtattgaa
ttccatgatatcccagacaccaaaggagttcctttagtagcagatatgtcatcaaatttt
gtatcaaaaccactagatatttcaaaatttgccttaatatatgctggagctcaaaaaaat
gttggcccatctggtgtaacaattgttattgtgcgaaaagattttattggcactgcaatg
tccatatgtccatctatctttgactttgcagtggttgcagcagaaaattctatccataat
acgccgccagtcttccaaatttactttgttggaagagtttttgaatggataaagaaaaat
ggacgagtagaaggcatggctgaacttgcccacaagaagagcaaacttatttatgatgtg
atagagcaatctaatggtttttatatatgtccaatcgacaaaaaatgccgtagtagaatg
aatattccattcagaataaagaatgatgaagcacttgaaaatgcctttgtagctggtgct
gctgctcttaatatgctacaacttaagggacatcgatcagttggtggtattcgtgcatct
ctctacaatgctgttactctagagcaagtagaggcattagcaaaatacatgaaagctttt
tatcaaaagcatgcgaattga

DBGET integrated database retrieval system