KEGG   Nasonia vitripennis (jewel wasp): 100116145
Entry
100116145         CDS       T01081                                 
Name
(RefSeq) inositol polyphosphate-4-phosphatase type I A isoform X10
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: PH PH_6 C2
Other DBs
NCBI-GeneID: 100116145
NCBI-ProteinID: XP_001600689
NASONIABASE: NV16003
UniProt: A0A7M7G2P7
Position
1
AA seq 1286 aa
MRFNKQELMTLATQPSQKFEKEGILYVRERQEGFFRRTESTGKKLDSKKQKGKTHKTLRD
FSCVSASTSKVSLERWCRLRGNLLFYFKSREQWSEPLGVIILEQFSVRVEQPTNQIPYGF
SIVFDGGVYQQLGANSSEERDSWLQALQLASYDCMRSQLLALRQRMEATSGHKHDTDIQM
LRLKRGITTDPAEIPMCEISLACDNLLCDGHGRPPNPVLEVDVQTCHAKTWVKYARTEVV
EKSSNPGFFTTVSFRASDGISAECRLRITAYDVRERVSQTATPIGSAIMTFSAVQDTPRL
RIPLKSAKATTVGFLTINVWNLEAEDKGNSTESTPSRNVPSTANQMYCHRRSQSLPPRLG
TKIKLPHQGQLKLLFANPHIQTYRFHSGLGGDICVHETMAESKLCFQFPQQLLGIWIQEE
KELLQEVAGMGELREPWHTKQVELLDRHLHLLHSYSQAKENLAAFKGSYFKQSSRKNERS
LEFAPLNLHLQRMWVHNDTLNKCGLYDFMSVGAFTAHSHKNKNGGLLRLVQALKESPVRG
TQLYQGTSKISMAHDAIQAIKQLRRDVVEAMRSLMKLAKEKQTSGMLPICEDMVSKTRIL
LSLWDPGLVEEALTFLEEHKVAKVQEDINNDDSLTLNFKVNQSLSPYKRITQQLNFDLRS
PDFDEFVTPDTPECVQDIWAKESAKSKYVSFAANNEINSNTEKQQTDENFVIFPEVEDEP
KETDTTETVDKENLNGEDNNNHNNEDEEKAEFDRVNDLDLSKRFLDTQKMCNSPSANYYK
PTDEPEPWDLTQLNIEASVMCLVSKVKFLCGRCSSPAVRLRNKNGIDRNQTLKSCLANNR
GNATAVVTIQPKNGIKSEEASKLLENGAQQSGTDKQNSAASKAKEVCQAMDSMTRVIKSN
SNQRNKFTEGLDFASIVDWTSELRPSMKKLRQAMDGLLKTARLTHSVFRVQEDTKTAIRV
CNVRYRRDVCFSQALTALVSGLMAKLWCQRPDPMFLLILTTLGPLVSFEGLLSYYGDEID
MWGDMAVAVEDMHTVTFTLSRCGIHTRVDGKSKATQFPSPRVIGSRTALTVLLPVPDAIY
SLLPLVPSSKQTLSFNVTPVFFNIGINEMASLAESLGTTKSQEKSNVDNFDRLNEYYLRF
KKLNLPTEPASARFGTRSALNQTLADMMINLKSSVQAKVNKNVEILQLSSQICRRMRGLR
FTSCKSAKDRTGMSITLEQVNILATEYHLAEHELIRALDCMRSEGCRRENTWKNIGVRKY
AFNSLQIMTLPKQYRPPIGTYGSAQT
NT seq 3861 nt   +upstreamnt  +downstreamnt
atgaggtttaacaagcaggagctgatgaccctggccactcagccttcccagaaatttgag
aaggaaggtatactttatgtacgggagcgtcaggagggcttctttcgtagaacagagagt
acaggtaaaaaacttgacagcaaaaaacaaaagggaaaaacacataagactctgcgagac
ttcagttgcgtttcagccagcacgagtaaagtaagcctcgagcgctggtgcagactccgg
ggcaacctcttgttttacttcaagtcgagggagcagtggtccgagcccctcggcgtcatc
atcctcgagcagttctccgtgcgcgtcgagcagccgaccaatcagattccttatggcttc
agcatagtgttcgacggtggagtctatcagcaactcggtgccaattcctcagaggagagg
gacagctggctacaagctctgcagttagccagctacgattgcatgcgcagtcagctgttg
gcgctcaggcagaggatggaagctacaagtggccataagcacgacaccgacattcaaatg
ctcaggctcaagcgcggcattaccacagatcccgcggagataccgatgtgcgagatctcg
ttggcgtgcgacaacctgctgtgcgacggtcacggccggccgccgaaccccgtgctcgag
gtcgatgtgcagacctgccacgccaagacgtgggtcaagtacgcgcgcaccgaggtcgtg
gagaagagcagcaatccgggcttcttcacgacggtgagcttccgggcgagcgatggcatc
agcgccgagtgtcggctccgcatcaccgcctacgacgtcagggagcgggtcagccagacg
gccacgccgatcggcagtgccatcatgaccttcagcgccgtccaggacacgccgagattg
aggatcccgctaaaatcggcaaaggccacgacggtgggctttctcacgatcaacgtgtgg
aacctggaagctgaagataagggaaacagtactgagagtacgccttccagaaatgtgcca
agtaccgccaatcaaatgtattgtcataggcgttcacagtcgcttcctccgagattgggt
acgaaaatcaaactcccgcatcagggacaattaaaacttctatttgccaatccgcatatc
cagacgtacagatttcattctggtctgggtggtgatatctgcgttcacgagacaatggcc
gaaagcaaattgtgttttcaatttccccagcaactgttaggaatttggattcaagaagaa
aaggagcttttgcaagaagtggccggcatgggcgagttgagggaaccttggcataccaaa
caagtagagcttctggatcggcatttgcaccttttacattcttattctcaagccaaagag
aatcttgccgcctttaaagggagctactttaaacaatcgtcacggaagaacgagagatcg
ttggagtttgcacctcttaatttgcatttacaaagaatgtgggtccataacgataccttg
aacaaatgcggactttacgattttatgagtgtcggggcttttactgctcattctcacaaa
aataaaaacggcggtcttttaaggttagtgcaagcattgaaagaatctccagtacgaggt
actcagctgtaccagggaacgtcaaagatctcaatggcccacgatgcgatccaagccatc
aaacaacttcgccgagacgtagtggaagcgatgcggtcacttatgaaactggcgaaggaa
aaacagactagtggtatgctacccatatgcgaggatatggtctcaaagactcgtatactt
ctcagcctttgggatcccggtctggtagaggaggcgcttacgtttttggaagagcataaa
gtagccaaggttcaggaggacataaataacgatgactcgcttacccttaactttaaagtc
aatcaatcgctttccccgtacaagagaatcacgcagcaactgaatttcgatttaagaagt
ccagatttcgacgaattcgtaacgccagacactcctgaatgtgtacaagacatttgggcg
aaggaaagcgcgaaaagcaagtatgtcagtttcgcagcgaataatgagattaatagtaat
acggagaaacagcagactgatgagaatttcgtgatattcccagaggtcgaggacgaacct
aaagagactgatacaaccgagactgtcgacaaagaaaacctcaatggcgaagacaacaat
aaccacaataacgaggacgaagaaaaagctgaattcgatcgtgtcaatgacttggacttg
agcaaacgcttccttgatacacaaaagatgtgcaattctccctcagccaattattacaag
ccaaccgatgaacccgagccctgggatcttacacagctgaatattgaggcgagcgttatg
tgcctcgtatcaaaagtgaagttcctttgtggacgttgcagcagtcctgcggtgagattg
cgtaataaaaatggtatagatagaaatcagacgctgaagagttgtctggccaataacagg
ggtaacgctactgcagtagtgacgattcaaccgaagaacggaatcaagagtgaagaagcg
agcaaattactagaaaatggggcgcaacagagcgggactgataagcagaattctgctgcc
tctaaggccaaagaagtgtgccaagctatggactccatgacgcgagtgataaagagtaat
tccaaccaaaggaataaatttacggaaggtctggactttgcctcgatcgtcgactggacg
agtgaattaaggccgagcatgaaaaaactacgccaagccatggacggcctgttaaagaca
gctcggctaacacactcagtttttagagtgcaagaggatactaaaacagccattcgtgtg
tgcaatgttcgatatcgtcgagatgtgtgcttcagtcaagcgctgacggctctagtatct
ggtttgatggcaaaactttggtgtcaacgacctgatcccatgtttttactgatcttaaca
acactgggtccacttgtgtcctttgagggcttattaagttactacggtgatgaaattgat
atgtggggggatatggctgttgctgttgaagacatgcatacagtcacctttactttgtca
cggtgcggcatccataccagagtagatgggaaatcaaaagccacacaatttccgtcgccc
agagtgatcggatcacgaactgctttgacggtgcttcttcctgtgccagatgccatatat
tccttacttccgttagtaccctcttccaagcaaactctctctttcaacgtgacgcccgta
tttttcaatatcggaatcaatgaaatggcttctctagccgaaagccttggaacaacaaaa
tctcaagaaaaaagtaatgtggataactttgaccgactaaatgagtattatttaagattt
aagaagttaaatctaccaactgaacctgcgtccgcaagatttggaacacgatcggctctt
aatcaaactttggccgacatgatgatcaatctaaaatcttcagttcaagcgaaagtaaac
aagaatgtggagatattacaattatcttcacagatatgcagacgtatgcgagggttaaga
tttacgagctgcaaaagcgcaaaggatcgcactggcatgtccattactttagagcaagtt
aacattcttgcaacagagtatcatctggctgaacatgaattaattagagctctggactgt
atgcgaagcgagggatgtcgaagagaaaacacgtggaagaacattggggtgcgaaaatat
gcatttaacagcctacagattatgactcttccgaaacagtatcgaccaccaattggtact
tacggctcggcgcagacttaa

DBGET integrated database retrieval system