KEGG   Nasonia vitripennis (jewel wasp): 100116297Help
Entry
100116297         CDS       T01081                                 

Definition
(RefSeq) hydroxypyruvate reductase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00260  Glycine, serine and threonine metabolism
nvi01100  Metabolic pathways
nvi01200  Carbon metabolism
nvi01230  Biosynthesis of amino acids
Module
nvi_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    100116297
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100116297
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     100116297
    1.1.1.399  2-oxoglutarate reductase
     100116297
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100116297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh IlvN AdoHcyase_NAD NAD_binding_2 NAD_binding_7 UDPG_MGDP_dh_C Gp_dh_N
Motif
Other DBs
NCBI-GeneID: 100116297
NCBI-ProteinID: XP_001600828
NASONIABASE: NV17542
UniProt: K7J831
Position
3
AA seq 511 aa AA seqDB search
MSVNLRSVLVSDPVDERCAALLTSHGVPVTTKYKLSKEELINELQKHDGLIVRSETKVTA
DVIAASPNLKLVGRAGTGVDNIDIPAATRNGILVLNTPGGNSVSACELTCAVISALARNV
VQAGQSMKEGRWDRKLYAGRELSGKALGVVGFGRIGREVAHRMKAFGMEIIAYDPFFTKE
QAAQIGVTKGELEDIWKNADYITVHTPLIPQTKNLINATTLAKCKKGVYIVNVARGGIVD
EEALLHSINAGHVAGAALDVFIEEPPKNPVTLELIKHPKVVATPHLGASTAEAQTRVAIE
IAEQFLAISGKSDKYSVTGIVNAPVMAAAANPDNAAWIELAKRLGKVAGKFVANQGQVVV
ESRTTGPDTASKKFVHTALNVGLLANRVNSGLNLVNAPNLAKELGITVNEGHENVGQNAI
VVKAGGHVVQGTVVGNATLLVSIDDSVFVDGVHLQDNISLYKAKSAQDLAQVVAAHVAKG
VAINNVSIAGNWIIVQTNKPVSLAVDGVESY
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcaatctcagaagtgtgctagtcagcgacccagttgacgagcgctgcgcagct
ctgttaacaagccacggagtcccagttacgacaaagtacaagttgtcaaaggaagaattg
atcaacgagcttcaaaaacacgacggcctgatcgtgcgctcggagaccaaagtcaccgcc
gacgtcatagcggcgtcgccgaatctgaagctcgtcggacgtgccggcaccggtgtggac
aacatcgatataccagcagccacccgcaatggaatattggtcttgaacactcctggaggc
aacagcgtcagcgcttgcgagctaacatgcgccgttatctccgccctggcgcgcaacgtc
gtgcaagccggtcagtcgatgaaggagggcagatgggaccgcaagctctacgctggtcgt
gagctttcgggtaaagccctcggtgtcgtgggcttcggccgcatcggtcgtgaggtagcc
caccgcatgaaagccttcggtatggagatcatcgcctacgatccgttcttcaccaaggaa
caagccgctcagattggcgttaccaagggtgagctcgaggacatctggaagaacgcggac
tacattacggtgcacacgccacttattccccagaccaagaacttgatcaatgctactacg
ctagcaaaatgtaagaagggagtttacattgtaaatgtagctcgtggtggtatcgtcgac
gaggaggcgctgcttcattcgatcaatgctggtcatgtagctggtgcagctctggatgtc
ttcattgaggagccacccaagaaccctgtcacactcgagcttatcaagcaccccaaagtt
gttgccacaccccatcttggtgccagcacggcagaggcccaaacgcgcgtggctatcgag
atcgccgagcagttcctcgcgatttccggcaagtccgacaagtattccgttaccggaatt
gtcaacgcgcctgtgatggccgcagctgccaaccccgacaacgctgcctggatcgagctg
gccaagaggttgggcaaagttgccggcaagttcgttgccaatcagggacaggtcgtcgtt
gagagccgtactaccggaccagacactgcctccaaaaagtttgtccacacggccctgaac
gttggtcttctggccaatcgcgtcaacagtggactcaacctcgtcaacgcgccaaatctt
gcgaaggagcttggcatcacggtcaacgagggtcacgaaaatgttggacaaaatgccatc
gttgtgaaggctggcggtcacgttgttcaaggtacggtagtcggtaacgccactctgttg
gtatcgatcgacgattctgtcttcgtagatggtgttcacctccaggacaacatctcgctg
tacaaagcaaagtcagcgcaagatctcgctcaggtcgtcgctgcccacgtcgctaagggc
gtagctattaataacgtcagtatcgctggaaactggataatcgttcaaacgaacaaaccg
gtttccctcgcggtcgatggcgtcgagagttattga

DBGET integrated database retrieval system