KEGG   Nasonia vitripennis (jewel wasp): 100116394
Entry
100116394         CDS       T01081                                 
Name
(RefSeq) glycoprotein 3-alpha-L-fucosyltransferase A isoform X2
  KO
K00753  glycoprotein 3-alpha-L-fucosyltransferase [EC:2.4.1.214]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00513  Various types of N-glycan biosynthesis
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00513 Various types of N-glycan biosynthesis
    100116394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:nvi01003]
    100116394
Enzymes [BR:nvi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.214  glycoprotein 3-alpha-L-fucosyltransferase
     100116394
Glycosyltransferases [BR:nvi01003]
 Glycan extension
  N-Glycan
   100116394
SSDB
Motif
Pfam: Glyco_transf_10 Glyco_tran_10_N
Other DBs
NCBI-GeneID: 100116394
NCBI-ProteinID: XP_001600902
NASONIABASE: NV15421
UniProt: A0A7M7G2Y1
Position
4
AA seq 447 aa
MALPRLSLKRCFLYVVCITGMLLVVMNVRQKEIWHGIRPEQVQPAARTMPDAAKMNNTTG
MPNSIENTIDISDPAKRPWYMKGGQRRPSPALKSRRTGRRQARLWPDEDPIDDRVTNQLM
FVPPDYNRSSLDIRFKKIYIPHGMNEAKSGPDLFFQQGCPVNTCMITRDNPNDADLILFK
DYVTHIGRRSPNQVWMLYFLECPYHTQSVKNAIVNWTATYRRDSDIVAPYERWQYYDSRV
TQIQQSFNYAANKTKKVAWFVSNCHPRNQRMHYAKELAKHIQVDIYGACGTLRCSRSQAQ
ACFDMLDADYKFYLAFENSNCRDYITEKFFVNGLGHNVLPIVMGAHPTDYARSAPYRSYI
HVDEFESPRELAQYLHRLDADDELYNSYFKWKGTGEFINTYFWCRVCSMLHDEQRTAKHY
RDVNEWWRGEGVCAANSWRELEHLRNT
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggccctgccgcgactatcgctcaaaagatgcttcctctacgtagtctgcatcacgggt
atgctgctcgtcgtcatgaacgtgcggcagaaggagatctggcacggcatcaggcccgag
caggtccagcccgctgccaggaccatgccagacgccgccaaaatgaacaacacgacgggg
atgccaaattctatcgaaaacacaatcgatataagcgatcctgcgaagaggccatggtac
atgaaaggcggccagagaagaccgagtcctgctttgaagtcacggcgcactggtagaaga
caggcgcgtctttggcctgacgaagatcctattgatgatcgcgtgacaaaccagctcatg
ttcgttccgccggattataacagatcaagccttgacatccgcttcaaaaagatttatata
ccgcacggaatgaacgaggcgaaaagcggtccggatctcttctttcaacagggatgcccc
gtaaatacttgcatgataactcgcgataatcccaacgatgccgatttgatcctctttaag
gattacgttacgcacatcggacgaagatctccaaatcaggtctggatgttgtactttttg
gaatgtccttaccatacacaaagtgtaaaaaatgctatagtgaattggacagctacctat
cggcgagatagtgacatcgttgcaccttacgagaggtggcaatactacgattctagagtt
acccaaatccaacaaagttttaattatgcagccaacaaaacaaagaaggttgcatggttc
gtctctaactgccacccccgcaatcaacgtatgcactatgctaaggagctggcgaaacat
attcaagtggacatctacggtgcttgtggcactttgagatgttcgcgatcccaagcacaa
gcttgcttcgatatgctcgatgctgactacaaattctatcttgcttttgagaattccaat
tgccgcgactacataacagaaaagttcttcgtcaacggtcttgggcacaacgtactacca
atcgtaatgggcgcccacccaacagactacgctcgaagcgcaccataccgttcgtacatc
cacgtagatgagttcgaatcgccgcgtgagctggcccaatacttacaccgactcgacgcc
gacgatgagctttacaactcgtatttcaaatggaaaggtaccggagagttcatcaacacg
tacttctggtgccgggtttgttcgatgctgcatgacgagcagcgcacggctaagcactac
cgagacgtgaatgaatggtggcggggcgagggtgtttgcgcggccaattcctggcgcgag
ctcgagcatctacgcaatacctga

DBGET integrated database retrieval system