KEGG   Nasonia vitripennis (jewel wasp): 100116573
Entry
100116573         CDS       T01081                                 
Name
(RefSeq) probable galactose-1-phosphate uridylyltransferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00052  Galactose metabolism
nvi00520  Amino sugar and nucleotide sugar metabolism
nvi01100  Metabolic pathways
nvi01250  Biosynthesis of nucleotide sugars
Module
nvi_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
nvi_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100116573
   00520 Amino sugar and nucleotide sugar metabolism
    100116573
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     100116573
SSDB
Motif
Pfam: GalP_UDP_transf GalP_UDP_tr_C DUF4931 RGS_DHEX HIT DcpS_C
Other DBs
NCBI-GeneID: 100116573
NCBI-ProteinID: XP_031782817
NASONIABASE: NV16608
Position
3
AA seq 363 aa
MSGSFNPTDHQHVRYNPLKGEWILVSPHRMKRPWGGQVEPSNDEEIPDYDPKNPLCPGNT
RANGDVTPNYERTYSFTNDFPALLENVPNPPEYDDELFQMGPARGTCRVMCFHPKSNVTI
ALMKVDEIREVIKQWINEMIELGKKWTWVQIFENRGALMGCSNAHPHCQIWASSFLPNEA
RIKDQQLRDYFSRHKVPLLFKYVKKEIAKKERIVLETREWVVLVPFWAAWPYETMILPKR
QVTRMQELTDDEQESLGAVMKTLCTKYDNLFQCSFPYSMGWHGAPTGPDVTEEYKHWTFH
GIYLPPLLRSATIKKHMVGYELLAQVQRDLTAEQAAEKLRSVPSFHYKYPDTSLSSEELS
KYI
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgagtggtagcttcaatcctacagatcaccagcatgtacgatacaatcctctcaaggga
gaatggattttggtttctcctcacagaatgaaacgaccttggggtggacaggtggagccg
agcaacgatgaagagattcctgactatgatccaaagaatccactctgtcctggaaatact
cgagctaatggagatgtaactccaaactacgaacgtacgtattcttttacaaatgacttc
ccagcacttctggaaaatgtaccaaatcctccagagtacgatgatgagctgtttcaaatg
ggtcctgcaaggggtacttgcagagtcatgtgttttcacccaaagtcaaacgtaacaata
gctcttatgaaggttgacgagattagggaagtaatcaagcagtggatcaatgaaatgata
gaattgggaaagaagtggacttgggtacaaatttttgaaaatagaggtgctctgatgggt
tgcagcaatgctcatccacattgccaaatttgggccagttctttcttgcctaatgaggct
agaattaaggatcaacaattgagggattacttcagtcgccataaagtacctctactcttc
aaatatgtgaaaaaggaaattgcaaaaaaagagaggatagtcttagaaacacgtgaatgg
gttgttcttgtacctttttgggctgcctggccttatgagactatgattttaccaaaaaga
caagttacaaggatgcaagagttaacagatgatgaacaagaaagtctaggagcagttatg
aaaactctgtgcacaaagtatgacaatttgtttcagtgttcattcccatattccatgggc
tggcatggagcccctactggtccagatgttacagaggagtacaagcactggactttccat
ggaatatacttaccaccattgcttcgttctgcaacaataaagaagcacatggtgggatat
gaacttttggcacaggttcaaagagatttaactgctgaacaagcggccgagaaattgaga
agtgtaccttcgtttcactataaatatccggatacaagcttatcatctgaagaattgtca
aaatacatttag

DBGET integrated database retrieval system