KEGG   Nasonia vitripennis (jewel wasp): 100116581
Entry
100116581         CDS       T01081                                 

Name
(RefSeq) mitochondrial folate transporter/carrier
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nvi02000]
    100116581
Transporters [BR:nvi02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   100116581
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 100116581
NCBI-ProteinID: XP_008202006
NASONIABASE: NV12874
UniProt: A0A7M7QJC7
Position
5
AA seq 312 aa
MCSTKSTDSKNKLSVFSHLKYEYLAAGVAGGTISTLVLHPLDLIKVRFAVNDGRVKSAPQ
YSGPINAFGKIVKNEGFVGLYRGIVPNIIGAGAAWGSYFFLYNCIKTWIQDGNTTKPLGP
WMHIVAATDAGVLTLLLTNPIWVVKTRLCLQYAEDVNLSETKRYSGTIDALKKITTTEGI
TGLYKGLVPGLFGVSHGAIQFMLYEEMKVKYNLYRNKPIDTKLETTNYIICAAVSKLIAA
AITYPYQVVRSRLQDHHHNYQGTLHCISSIWKYEGWRGYYKGLSANLLRVTPATVITFVV
YEHVSSYLLSHK
NT seq 939 nt   +upstreamnt  +downstreamnt
atgtgttcgactaaatctacagattcaaaaaataaactttcggtcttcagccatctaaag
tacgaatatcttgcagctggagtggctggcgggacaatttccactttagtgctgcatcca
ttagatcttataaaagtgcgttttgctgtcaatgatggccgtgtgaaatcagctccacaa
tatagcgggccaataaatgcatttggaaaaatagttaaaaatgaaggtttcgtcggttta
tatcgaggaattgtgcccaatataataggagcaggagctgcgtggggatcgtactttttt
ctttataattgtataaaaacttggattcaagatggaaatacgactaagcctctcggacct
tggatgcatatagttgctgctacagatgctggggttcttacacttttactaacaaatcca
atctgggtggtaaaaactagattatgtttgcaatatgccgaagacgtgaatctttctgaa
acaaaaagatattctggaacgatagatgctttgaaaaaaattactacgactgaggggatc
actgggctatataagggtttagtaccaggtttgtttggtgtttctcacggagccattcaa
tttatgttatacgaagaaatgaaagtcaagtataatttatacagaaataagcccatagat
accaagcttgaaacaacaaactacatcatttgcgcagccgtttctaaattgattgcagca
gctatcacatatccatatcaagttgtaagatctcgattgcaagatcatcatcataattac
caaggaacacttcattgcattagtagtatatggaagtatgaaggatggagaggttattat
aaaggacttagtgcaaaccttttaagagtaactccagcaacagttataacgtttgtagtt
tatgaacacgtttcgagctatcttttaagtcacaaataa

DBGET integrated database retrieval system