KEGG   Nasonia vitripennis (jewel wasp): 100116664
Entry
100116664         CDS       T01081                                 

Definition
(RefSeq) myrosinase 1-like
Organism
nvi  Nasonia vitripennis (jewel wasp)
SSDB
Motif
Pfam: Glyco_hydro_1 Cellulase Toxin_15
Other DBs
NCBI-GeneID: 100116664
NCBI-ProteinID: XP_016842778
NASONIABASE: NV18339
Position
3
AA seq 503 aa
MCRKALIKIYVFIFILIIITLLVFNSSDKSADIDYSFPDGFLIGAASSSYQVEGAWNTSG
KSESVWDNFVHTRPEKIADRSTGDIACDSYHKYKEDIQLMKDIGINHYRFSLSWARILPT
GYSKDVNKEGLRYYHNILDELEKHKIEPMVTIYHWDHPQSLERLGGWMNELMADFFADYA
TVVFREFGHRVKMFTTINEPYIYCIVGYKTLRFAPGLNLSGWGAYQCVHNMLKAHAIAYH
IYDREFRSQQNGKIGIIMPCFQHYSKDKNDLVSTNIAFEFQCGWTAHPIFSKDGDYPKIM
KQMIAKNSKLEGRKRSKLPTFSKQWIEYIKGTSDYFGLNHYTADLVEPSPEAAAFDSLND
DGLLYTVDEKWLSSQSKWLKVVPDGLGEILRQIKNRYNNPPVYIMENGVSDPNTVNDTIR
IQYLYAYMKEMLVAMKRDNCNIKAYTIWSFLDSFEWDMGYVDHFGLISVDFNDPNRKRTP
KKSVSWLKSVLKSRKLMPIIDYT
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgtgcagaaaagctttaattaagatatacgtatttatatttatattaataatcataaca
ctactagtgtttaatagttcagacaaatctgctgatattgattattcatttcctgatgga
tttctcattggtgctgcttcatcttcttaccaagttgaaggagcttggaatacaagtggt
aaaagtgaaagtgtttgggataactttgtgcacacacgcccggagaaaatagcagatcga
tccactggagatattgcgtgcgattcctaccataaatataaagaagatatccaattaatg
aaagatattggtataaaccattatagattttctttgagttgggctcgaatactcccaacg
ggttactctaaagacgttaacaaagaaggtcttcgttattatcacaatattcttgatgaa
ttagaaaaacataaaatcgagcctatggttactatatatcactgggatcatccacagagt
ttagaacgattgggtggttggatgaatgaattaatggcagatttttttgctgattacgca
actgttgtatttagagaattcggacatcgagtaaaaatgttcactaccatcaatgaaccg
tatatatattgtattgtaggctacaaaaccttacgatttgctccaggtcttaatctaagt
ggttggggtgcatatcagtgtgttcataacatgttaaaggctcacgctattgcttatcac
atttatgacagagaatttcgtagccaacaaaatggtaaaatcggaatcatcatgccatgc
tttcagcattacagtaaagataaaaatgatttggtgtctacaaatattgcttttgagttt
caatgtgggtggactgcgcatccaattttttccaaggatggcgattatccaaaaattatg
aagcaaatgatcgcaaaaaacagtaaactcgagggtcgaaaaagatccaaactacccacg
ttttctaaacaatggattgaatacattaaaggaacttcagattattttggactcaatcat
tacactgctgatttggttgaaccatcacctgaagcagcagcatttgattctctgaatgat
gacggattactttatacagtagatgaaaaatggctttcaagtcaaagcaaatggctaaag
gttgttcctgatgggttaggagaaattttaagacagattaaaaataggtacaacaatcct
cctgtttatataatggaaaatggagtctcagatccaaacactgttaacgatacaattagg
attcaatatttgtatgcatacatgaaagaaatgcttgttgcaatgaaaagagataattgt
aatataaaagcttacacaatatggagtttcttagatagcttcgaatgggatatgggttac
gtagatcactttggacttatcagtgtcgatttcaacgatcccaacagaaaacgaacaccc
aaaaagtcagtttcgtggctgaagtcagttttaaagtctcgtaaattaatgcctataata
gattacacctaa

DBGET integrated database retrieval system