KEGG   Nasonia vitripennis (jewel wasp): 100116896Help
Entry
100116896         CDS       T01081                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00250  Alanine, aspartate and glutamate metabolism
nvi00330  Arginine and proline metabolism
nvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100116896
   00330 Arginine and proline metabolism
    100116896
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     100116896
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 100116896
NCBI-ProteinID: XP_001601273
NASONIABASE: NV13117
Position
2
AA seq 568 aa AA seqDB search
MLSLCRQSSFLANAQKISTRCLGTIVPVPKPKEFPLENEPILTYKKGSKERAELEKALDK
MAGECEEIPIVIGGKEIKSDIVKYQTMPHNHQHKIAKYYYATPDLLKKAIDVSVKTQREW
EKVPFEKRLDIWLKAADLMATKYRQQLNASTMLGQGKTAIQAEIDSAAELIDFFKMHGYF
VKEALKYKPISPNKETLNSMRYRGMDGFVAAVSPFNFTAIGGNLSYTPALMGNSVLWKPS
DTAVLSNWWIYKICKEAGVPDGVVNFVPAHGPDFGDTITASPYLSGINFTGSVPTFNRLW
TQVGKNINIYKNYPKLIGECGGKNFHFVHPSADVESVVSGTIRSSFEYNGQKCSACSRMY
VPESLWSKIKAGLLSTRDQLKMGDPRDFSVFLGAVIDATAFKRITGYIEHAKKSPDLEII
GGGGYDNSRGYFIEPTIVQTKNPKDKIMTEEIFGPVLTIYVYKDTNLDETMKLVESSTPY
ALTGAIFSQDEKWAIHALEEFRYAAGNFYVNDKSTGSVVGQQPFGGGRMSGTNDKAGGPH
YALRWASPQSIKETFVPLREYDYEYMRS
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgctgagcctctgccggcagtcgtcgttcctcgcgaacgcgcaaaaaataagtacaaga
tgcctgggaaccattgtgcccgttccaaagccaaaggagtttcctttggaaaacgagccc
attctgacttacaaaaaaggcagcaaagagcgagcggagttggaaaaggctttggataag
atggctggtgaatgtgaagaaatcccaattgttattggtggcaaggaaattaaatcagat
attgttaaatatcaaactatgccacataaccatcaacataaaattgctaagtactactat
gcaacgccagacttacttaagaaagctattgatgtttctgtaaaaacacagagggaatgg
gaaaaagttccttttgagaagcgtttggatatttggttgaaagcagctgacttgatggca
acaaagtacaggcagcaattgaatgcatcaactatgcttggtcagggaaaaactgccatc
caagctgaaattgacagtgctgcagaactcattgatttcttcaagatgcatggttatttt
gtaaaagaagctttgaaatacaaacccatatcaccaaataaggaaactttgaattccatg
aggtatcgaggaatggatggatttgtagctgctgtttcaccgtttaacttcactgccatt
ggtggtaaccttagctatactccagctctgatgggaaattcagtactatggaagccatct
gataccgccgtgttatctaactggtggatatataagatttgcaaagaagctggagtacct
gacggagttgttaatttcgttcctgctcatggtccagattttggagatactatcactgcc
tcaccatatctttctggaattaactttactggttcggtaccgactttcaatcgcctttgg
actcaagttggaaagaacataaacatatacaaaaactatccaaaattgattggagagtgc
ggcggtaaaaacttccactttgtgcatcctagcgctgatgttgaatcggtagtatcaggt
acaattagaagttctttcgaatacaatggtcaaaaatgctcagcgtgcagtcgaatgtat
gttcctgagtcactatggagtaagatcaaagctgggcttttatctactcgtgaccaattg
aagatgggagacccaagagatttttctgtattccttggagcagtaatcgatgctacagct
tttaagagaattacgggttacattgagcatgccaagaaatctccagatcttgagattatt
ggtggaggtggctatgacaactctcgcggctactttatcgaacccaccattgtacaaaca
aaaaatcctaaagataagataatgactgaagaaatttttggacctgtattaacgatttat
gtctacaaagacacgaatcttgacgaaacaatgaaattagttgaatcctctacaccttac
gctttaactggagcaatattttcgcaagacgagaaatgggcaatacacgctctggaagaa
tttagatatgctgctggaaacttttatgtgaacgataaatcgacgggatcagttgtaggc
cagcaacctttcggtggcggtcgtatgtccggaacgaacgataaggctggaggtcctcat
tacgccttgagatgggcatctcctcaatccatcaaggaaactttcgtaccccttagagaa
tacgactacgaatatatgcgttcgtaa

DBGET integrated database retrieval system