KEGG   Nasonia vitripennis (jewel wasp): 100117105
Entry
100117105         CDS       T01081                                 

Name
(RefSeq) beclin-1-like protein isoform X1
  KO
K08334  beclin
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04136  Autophagy - other
nvi04137  Mitophagy - animal
nvi04140  Autophagy - animal
nvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100117105
   04136 Autophagy - other
    100117105
   04137 Mitophagy - animal
    100117105
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    100117105
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100117105
   03029 Mitochondrial biogenesis [BR:nvi03029]
    100117105
Membrane trafficking [BR:nvi04131]
 Autophagy
  Autophagosome formation proteins
   PI3K complex
    100117105
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    100117105
SSDB
Motif
Pfam: APG6 APG6_N FUSC ATG14
Other DBs
NCBI-GeneID: 100117105
NCBI-ProteinID: XP_001601439
NASONIABASE: NV15432
UniProt: A0A7M7G3C7
Position
4
AA seq 448 aa
MVDMKSNVNFACQRCLQPLRLDPSFNHLGEHTIAELSLPIQHHVVREVEQQSGSLEHLVP
PFRLTESANGTNGFMLVGDSGETEGLSHHLRVRATLFDVLSSSSSADHPLCDECTDSLLM
LMDQQLRLTEGEWSDYNEYLKKLEAEQLQQGNEETEIEALEKELQDVKAEEERMIRELEA
LRKEEAATKNAIAEQERERERLQSEEERYWREFSRHRRDLILAEDECRSLECQLAYAASQ
LERLKKTNVFNATFHIWHSGHFGTINSFRLGRLPSAPVDWSEINAAWGQTTLLLTALARK
MNLTFQRFRLVPFGNHSYIEVLDQHKELPLYGSGGFKFLWDTKFDAAMVAFLDCLQQFKE
QVEKGDSGFCLPYRMERGKIEDSATGNSYSIKIQFNSEEQWTKALKFLLTNLKWGLAWVS
SQFTKDEAEQCSTLNQTDLKPTTTNVLS
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggtggacatgaaatctaatgtgaatttcgcgtgtcagcgatgtctacaacctttaaga
ttagatccaagtttcaatcatctaggagaacatacaatagctgaactatcattacctatt
caacatcatgttgtcagagaggtagaacaacaaagtggcagcttagagcatttagtacca
ccatttcgcctcacagaatctgcaaatggaacaaatggctttatgttagtgggtgactca
ggagaaacagaaggcctaagtcatcatttgagggtgcgagcaacgttgttcgatgtgctc
agtagtagtagttcggctgatcatccattatgtgatgaatgtactgatagcctattgatg
ctaatggatcaacaacttaggcttacagaaggtgaatggtctgattacaacgaatacctc
aaaaaattagaagccgagcagttacaacaaggcaatgaagaaactgaaatagaggctttg
gaaaaagaactgcaagatgtcaaagcagaagaagaaagaatgattagggagctagaagca
ttgaggaaagaagaggcagctacgaaaaatgccatcgctgaacaagaaagagagagagaa
aggctgcaaagcgaggaagaaagatattggagagaattttcacgtcataggagagatctt
attttagcagaagatgaatgtcgcagtttggaatgtcagctggcctatgcagcatcacaa
cttgaaagactgaaaaagaccaatgtttttaatgccaccttccacatctggcactctggt
cattttggcactataaattccttcagattaggcaggttaccaagtgcacctgttgactgg
agcgaaattaatgcagcatggggacaaacaactttacttttaactgctttggctcggaaa
atgaatttaacatttcaaagatttcgattagtaccatttggtaatcacagttacattgaa
gtccttgatcaacacaaagagctgcctttatacggcagtggtggattcaagtttttatgg
gatacaaaatttgatgctgctatggttgcctttcttgactgtttacaacaatttaaggaa
caggtagaaaaaggtgacagtggattttgccttccatacagaatggaacgaggaaaaatt
gaagattctgcaactggaaactcatattcaatcaaaatccaatttaattccgaggaacag
tggaccaaggccttaaaatttctgctgacaaacttaaagtggggacttgcatgggtcagc
tctcagtttacaaaagatgaggctgaacaatgttcaacattaaatcaaactgatctcaag
ccaactaccacgaatgtgttatcatga

DBGET integrated database retrieval system