KEGG   Nasonia vitripennis (jewel wasp): 100117426
Entry
100117426         CDS       T01081                                 
Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00510  N-Glycan biosynthesis
nvi00513  Various types of N-glycan biosynthesis
nvi01100  Metabolic pathways
nvi04141  Protein processing in endoplasmic reticulum
Module
nvi_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100117426
   00513 Various types of N-glycan biosynthesis
    100117426
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100117426
SSDB
Motif
Pfam: Ribophorin_II
Other DBs
NCBI-GeneID: 100117426
NCBI-ProteinID: XP_001601669
NASONIABASE: NV18354
UniProt: A0A7M7G6W1
Position
5
AA seq 650 aa
MMNPKWVLLLLAALISTSLTADVPSSTSSYLTATDKARLKKVVEPGFKLQDLSSVHYAVF
GFRHIKEPITRLAEVCEFLIKSAGDSSLTTEQLYYLATTWKSLEQCQPKSLPLSALTKSL
TAVLEKDAAKIPELYHAVNALVSFGQKIPDAAVAKIVKTLQATLKKDDSPLNLGYVFHIA
ADLGSAGAFAFNHIEDAIVQADEVDGRFLQFEGGLGVTSLLVNGVFKLSSSLKKKPPLTS
QQTVKLANYFLSRRSVQTPKGAVNFLSSINILATNEFEKPICIALSEDGVVVSAKQPLVR
VKVCDLLGNPVPSVTNVIANTATKVTDDVVVISKKNFQATPNDKTLFTLNFMSATPEPGF
YKIAVSAGSVANTVTIKVLAEVKVDYLEIGTADADQTTQPKLVKVAHPQKLNQKIEADSQ
QKLVIRFLLKDASKNKPMRVHQAFVRLASVSSEKDKQEIIFVAEPDASHVYKFDMPVGTA
AKNFNYQSGDYNVELIVGDAVLSNSFQWTLATVSLKFPEPSASDVVEKSTYRQKPNVYSP
KPEIKHMFREPEKRPPAFVSNLFTGLCLSPLLVLFVLWYKLGVNISNFPFTLSAVVFHLG
LGSIFVLFGIFWLKLNMFTTLRYLLLLGLVTFLSGNKLLSQIARNRKASR
NT seq 1953 nt   +upstreamnt  +downstreamnt
atgatgaatcccaagtgggtgctgttgctgcttgcagccttgataagcacatctttaaca
gccgatgtaccatcttcgacaagttcttatctaacggcgactgacaaggctcgccttaaa
aaagttgttgaacctggatttaagctgcaagatctgtctagcgtgcattatgcagttttt
ggatttaggcatatcaaggagcctataactagacttgcggaagtctgtgaattcctgatt
aagtcagctggtgattcgtcgttaaccacggagcaactttactacctggccactacatgg
aagtctctcgaacaatgtcaaccaaagtcacttccattgagtgcactcacaaagtctctt
acagcagttttagaaaaagatgctgctaaaattccagagctgtatcatgctgtcaatgct
cttgtatcatttggacagaaaatcccagatgcagcagtagcaaaaatagtaaaaaccttg
caagcaacactgaaaaaggatgatagcccattaaacttgggttatgtcttccacattgct
gctgatctaggatctgctggagcatttgccttcaatcatattgaagatgctattgttcaa
gctgatgaagtagatggtcgtttcttacagtttgaaggaggacttggtgttacaagcctt
cttgtcaatggagtattcaagctttcttcaagcttgaagaagaagccaccactaacatct
caacagaccgtcaaattggcaaactatttcttatcgcgtaggtctgttcaaacgcccaag
ggtgctgttaacttcctttcatcaatcaacattctggctaccaatgaattcgaaaagcct
atttgcattgctctatcggaggacggagttgtcgtttctgcaaagcaacctcttgtccgc
gttaaagtgtgcgatcttcttggtaaccctgtaccatcagtcaccaatgtcattgccaac
actgctacaaaagttacggatgatgtcgttgttatcagcaagaaaaatttccaagctaca
cctaacgataaaacgttgttcactttgaacttcatgtctgcaacaccagagcccggcttc
tataagattgcggtatctgcaggttcggttgctaacacggttacaatcaaagttcttgct
gaagtcaaagtcgactatttggaaatcggaacagctgatgccgaccaaactactcaacca
aaattagtaaaagtcgctcatcctcaaaagcttaatcaaaaaattgaggctgattctcag
cagaaacttgttatccgctttttgctgaaggatgcctctaaaaacaagccaatgagagta
catcaagctttcgttcgtcttgcgtcggtatcatcagaaaaagataagcaagaaatcata
tttgttgctgagccagatgcttctcacgtttacaaattcgatatgcctgtgggaacagct
gctaagaatttcaactaccaaagcggagattacaacgtagaactcattgtcggtgatgcc
gttttgagcaactcctttcagtggacactcgccactgtgagtttgaaattccctgaacca
tcggcttcagacgttgtcgaaaaatcaacttacaggcagaaacctaatgtatactctcca
aagccagaaattaagcacatgttccgtgagcccgagaaaagaccaccagcattcgtttcg
aatctttttactggattatgtttgtcaccattacttgtcttgtttgtcctatggtacaag
ctaggagtaaatatttcaaacttcccgttcactctgagtgctgtcgtctttcatttagga
ttaggaagcatattcgtactatttggaatattctggctgaagctgaatatgtttactaca
ctccgatatcttcttttacttggactagtcacattcctgtctggaaacaagttattgtca
caaattgcacgcaaccgaaaagcatctcgttag

DBGET integrated database retrieval system