KEGG   Nasonia vitripennis (jewel wasp): 100117525
Entry
100117525         CDS       T01081                                 
Name
(RefSeq) dnaJ homolog subfamily B member 12 isoform X2
  KO
K09518  DnaJ homolog subfamily B member 12
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100117525
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:nvi03110]
    100117525
Chaperones and folding catalysts [BR:nvi03110]
 Heat shock proteins
  HSP40 / DNAJ
   100117525
SSDB
Motif
Pfam: DUF1977 DnaJ TPR_2 TPR_8 TPR_14
Other DBs
NCBI-GeneID: 100117525
NCBI-ProteinID: XP_008206442
NASONIABASE: NV15676
UniProt: A0A7M7H4Z3
Position
3
AA seq 467 aa
MTSACSHTLIYILAVILISIISAAEQHCRYSKSRVTSTEYLLQCVHVRADAAAEVKRYSR
AARVYKAAALARFAYFVPAICESAGQVAAAAAVATRKRRAAVDDAMDSNKDEAERCTELA
ERYVREKRFDDAEKFLRKAQRLYPTKKAEDLLTTVTLLSKQSQKSEPEPEVRKRPNAAKS
NGPHVQTTIEYSEEQIEHVRRIKKCKDYYEILGITKEATDSDIKKAYKKLALQLHPDKNK
APGAAEAFKAIGNAVAVLTDTEKRKQYDLYGSDEDRISSSRTTHTHYNYTRGFEADITAE
ELFNMFFGGFPQQEFYMRRGGGRWMRQNEAQAQHAHSQQANGYTTFLQMLPVLLLIVLTM
MSSFFISDPIYSLHHSSKYSVHRVTQNLKVPYYVKENFHTEYEGNLRRLEHSVEEEYMNF
LRHSCYRERNYRESMMWKARSFGDQEQFQRARNIETPSCKKLQEMQA
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgacgtcagcctgttcacataccctaatatacattttagctgtaatacttatatctata
atatctgcagcagagcagcactgtaggtacagcaagagccgagttacgagtacggagtac
ctactacagtgtgtccatgtccgagccgatgctgccgccgaggtaaaaaggtacagcaga
gctgcgagagtgtataaggcggccgcactcgcgcgatttgcctattttgtaccagctata
tgtgagagcgcgggtcaagtagcagcagcagcagcagtagcgacgaggaagaggcgagct
gccgtagacgacgcgatggacagcaacaaggacgaggccgagcgatgcaccgagctggcc
gagcgctacgtgcgggagaagaggttcgatgacgcggagaagttcctcaggaaggcccag
cggctctaccccacgaaaaaggccgaggatttgttgacaacggtaacattactgtccaaa
caaagtcaaaagtcagaacctgaaccagaagtcagaaaaaggccaaatgcagccaaaagt
aatggtccgcatgttcaaactacaatcgaatattctgaagagcaaatagagcatgtgaga
agaataaagaagtgcaaagactactacgaaattttgggaataaccaaagaagcgactgat
agtgatattaagaaagcgtataaaaaattagctcttcaattgcatcctgacaaaaacaaa
gcaccaggtgctgcggaagcatttaaagctattggaaatgcagttgctgttctcacagat
actgaaaaaagaaaacagtatgatctgtatggctcagatgaggacagaattagcagtagt
aggacaacgcatactcattataattacactcgtggctttgaagccgatattactgctgag
gaattgttcaacatgttctttggtggatttccacaacaagaattttatatgcgtaggggt
ggtggcaggtggatgagacaaaatgaagcacaagcacaacatgctcactcacaacaagca
aacggctatactacattcctgcaaatgttgcctgtactattactaatagttttgacaatg
atgagcagttttttcatctctgatcctatttatagtttgcatcatagttctaaatattcg
gtacacagagtaactcaaaatctcaaagtaccatactatgtaaaagagaactttcatacg
gagtacgaaggcaacttgagaaggcttgaacattcagttgaagaagagtatatgaatttc
ctacggcattcgtgttatagagagagaaattatcgggaatcaatgatgtggaaagcaaga
agtttcggtgatcaagagcaattccagagagcgagaaacatagaaacgccatcttgtaaa
aaacttcaagaaatgcaagcgtag

DBGET integrated database retrieval system