KEGG   Nasonia vitripennis (jewel wasp): 100117554
Entry
100117554         CDS       T01081                                 
Name
(RefSeq) baculoviral IAP repeat-containing protein 6 isoform X1
  KO
K10586  baculoviral IAP repeat-containing protein 6 (apollon) [EC:2.3.2.23]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04120  Ubiquitin mediated proteolysis
nvi04214  Apoptosis - fly
nvi04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100117554
 09140 Cellular Processes
  09143 Cell growth and death
   04214 Apoptosis - fly
    100117554
   04215 Apoptosis - multiple species
    100117554
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:nvi01002]
    100117554
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:nvi04121]
    100117554
Enzymes [BR:nvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     100117554
Peptidases and inhibitors [BR:nvi01002]
 Peptidase inhibitors
  Family I32: IAP family
   100117554
Ubiquitin system [BR:nvi04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   100117554
SSDB
Motif
Pfam: UQ_con BIRC6 BIR UEV
Other DBs
NCBI-GeneID: 100117554
NCBI-ProteinID: XP_008203648
NASONIABASE: NV18397
UniProt: A0A7M7H832
Position
4
AA seq 4794 aa
MADDDPWLLKEQGFLNVGTECKQIIYHPNLNVLLITTASAQVHVFDVNCGLVLQRCTLSG
KTEGKLQGIYLGEGVDKILYTDGRGIGVRGDYNGVLLLDSILQMPVFRSGDTIKLEMLLS
EAILLHHCLRSVELPGVNHVQEVLQELSTTIAYAKTSRKKGIKAQKWNTICLELPHGALK
LVCSNLVDYLKKQNKHIPALPIASAISERLNGLLPGLAMESGTVDKVLMFSEAARRDTFS
KWPHMNYKWALPDQMAQAGFYHQPNSTGEDRAMCFTCSVCLVCWEPTDEPWSEHERHSPA
CPFVKGEYTQNVPLSVTLATAPAQAAGETVDVIGTTNVTGLLSTASNNGFINVWNVHNQL
KREISFYISPSESEIYSRDSVQFVASKTAPTTCPFIPNLVSESNPLVDAYKPTSSALGST
NSKFQLTALALVDGPKSTSESKSTNSSAGATIMTQDTSSVGGTSIRPCLVCGVSVTSSTA
GGSIGSVSGSSSATTAQHQLRSLENVWATSTDLASSSSLVRAMNSVNSAASSNSLDIMKV
ATADDTCSPAKSHYLVLCDFHHKTAQPQPAKKDGSKDTSKSKKQLSGTGTSASSNGVRQE
SLYQEILLSNFLLEEINEDVDSEMVGSTHFDSIYAAPHTVLATPTANGIFYGVPMNSSIP
TSSSFDANSNPISPYVPEQFASTSKMTQLRKTLDTIKTTKAEPVVIQTIRIEAADSLRIN
KVLTTKDGKHLFVTLSPQPNTNATETFSNTNQMDVDDETTPKSFMYWDHNDVQSKPLING
ETQNEEESSVNSILLVYALDFSDTVVKLTTEPVLRRELPPDQAPNDCILLPTLEKGRLGS
SSLSSGMQYTASMASDSLSAHEPRGQVALVCRDGVVRLLDLSNLKTVTETKLDGKKFISA
AYCTRLERLCACTSDGALHFFSMTAEDDSTEEKDVDDLQMITDTSISDESELATPSTSTS
PPLNQEHILAYKQHLTYSDLRTLYDLTRFDRRSPPYSATVPPCWSEMMQAQRQRRYPQHL
HQSEDQHHTRTWRLQNDATTWDEHIFELTLPRSAAGNVGHVDVRFSLQFPCLELPMIQVT
LLKQNMTGIGNKSLLIPVDEKIDFKIGREQKADNPIITEEYQRHHNTEILCGPVNLQRCM
DLSDHSGCVTLTSPKLFRTKAKTLLVHIKALIEPTKEGASSKSRSSLLESKPPTSKKLRI
DEAGPFPPGVTVERFAATATKKLDCYIGCDWIHEVSITVRSVLPTNIPNEKLQRCAMLES
KTFIDNLLSVACLQTSDKSPVVQSLALDILIWVAAIRLTRLRTGIDSTKTKAIQLETVRC
VQERLPCLLRTCLFHAGRSIAHKCVKIVVLCSEGLHSLDDSAPHAFEETVLSVLVTLLPN
IVSVQWAGSLRWLAVLVTRLLPLDRNHSVAQQCINLIQEISVEMSKRVNPYHLLLATRFG
LYNSPFETELFDMDPPVSPKSSSVPVTNTYSSITAGEQPVTSVTSATSSYTQDAIDLRDL
LSLPSHSAGDLIVPSKLKALCANNSMKGLLEVEPLHFTCHAASDGTKMEKIDPSVNTVTI
GGALYDSAAPTVTIATSSDTKVIHHAYNFEAGSLGADVQFKLIDHKLTDLLSQCTKNAPK
ANYEALSKKSQDFYTPDDQSDSDEASNTQSATTSFWTLCNDKSPTLTSVLKEKSSSVTNV
GTSASKVEDTGAKKRDDISFPWGRLLCCPPQQALVVERMHSGARRFVILDFGAPVLLTDL
IIPACSDLVSLSIDIWTRSEETDGIRLVVAGDIGNKPLVVSDLQPPPVCRFLKITTIGRY
GMSTTRCKIPLGMFYGHMVVLPGEDYSELTASETNINNISDPVLQSTIESQCTILSALAE
DVQCRFTLATERLKGYLDPLLCTETPNVIHMQHYLSHSKNASDSKDQPSSKILSTYQECI
MYQHQLNTIRGVWQRLESWRSVESATQNTLASASSDKLRILGETLLDILLYTVYEIGPIP
TVPTTLYETFTPTVCEQLFNSICVMTPAPHLQLYAVALLARMAGHQPWWGNFLANTLISL
YSASSTHIFPQDRVFILLTFLGRKSLIAAANKSSVVDAMVRTLGRLLAPLSSGQTDNSSR
LDITLIGWVLLFLSVCLDTTAVHPTSSEDNHDKNKEQGTRGFSSRWEFIQGELAMQRKFV
SSSRSSASRSYRKKLQKRLMHHKQQLQDLEQAKKSFHTSSQTHSMLSTQSATFSSKLEQA
LKSQERFYKKTLKQHSAKHFKDLFSIRRNELHLNRSPRSQPQPSTSQADPPDPEGDYSTN
LSHQHVLPVARGLVALLLNIASNVDMFLLACKVVARLVVSTRPAISLGELMTEDQLLKLI
RLATGSSDTAWSSHAVCCLLQDLLEGEKLYPRNSAANEQSVSEEPYDPLSSEDARAADDD
SAAAGTSTSSNTFGNDEGFADGDEDTQDSISVAPTNASTSKASGFNLPSLMESDDSEFEE
FLDNILERGKTILKKGSAVSKYPTITSSGISQAIDARLEYGVETGVEISLRRLSALGTYN
LPLGINATINPTTDSTRHSQPSTSRQSSYSERNQDSWNSSDPPPSSLFMLTRCFDKIFSE
LYIQGSGTNLELILQLWLTLNLDATSESNSSNFDASLTPVIPLSSTAITGLISAFSWHPG
VSLRAWCYVLQCLTLASNQPLQAEQVEAASCSTPLDGLLGGMAGCIIKERNMGAMLLRLL
SGNGLNVDTTNKHFGMAGPTLCQALQDFLLRLEMRCDAATPGSALGNSLKELLLWVVYQL
VQPGGALVARRGPLDAQCKLITSLLQFSFTNTDLGTAMSISECVGELVSTYVRGAGVGAQ
CGGTTDATSQSGGFGGLYACVLGSDARQGRPASWDALVVALIKLVTKLVQTPLPNARTTR
SDSTTEMELGESSQSSNSSLNDSQEKMNTSQTDESKVAEQQTSSRTHSTSKPRVPCVADT
VLQHEPTMMRLLGSLGHSSGSSLAMLLGETSSTNATTELTAPPSIPDATFQLLCTLTKKA
SNPVLVLNPVYQYLASSCRQGISDRHMDVMQLSEPLLWFILRVLDNEASLSVFTSMGGVK
VLCENLVKSSKSRSGNGSNSPGVIALVMQHLSNSTSLTPVVSSSSSKKSANALEFFEDGL
LNFAPLGTVSWLHPTAQPADVLIQSATPHRRARTAAWSYHFYPDEAWVDLTITLPCAILL
KEVELQPHLASLSTCPSAVALEISREGNTALSPICPPMPTAGLTFIRLTLSQPEVATAVL
VRLYKPRDSTNISLSQIRLLGTTAFGDPKSSHDIIDEEQLTKTSLGWLRLVHQCLSVSTV
NSNLTAQVLNSAASVDGIIESCCNLLLLPAPSLFTPNLERVLLQLGLHSCELGLRLINLL
LNNRTAPLLQGSVLSQETTTIQMVVELLEQLCSAQDSNTKTRMSAVLNWLYTVAKSSASD
NENNSSFGMTNLATPPAVYIHCISTIIWKAAKLENLNYDLKELVTEDLFDALYQWTLILK
THSALKQAIDAVLCAFCCVKPEFFQLLLQRVQILVPNMSNEQAGASISDDRKESEGQTDD
IKSVADLNDWYAHLAQSQFKRLSLTEGQLLSIAAAARSTPGICQLLNSGLTTLLTACIVE
FAILEKAKQTHEHQRQQQQHQHHEADKLTTEEPSSPSSVDKDAASCSGMTDSDKAGESTT
QGNKIEGLDMNEPESIAIVLEFLSLICSEGKMRDWLGKDGSGFWLPLLTLLSDRPIENPS
TSSLRCSKTSISYAKLEAAMIKFLSKCCWCHPANQKLLAELLTEVIIQQKTPAGSRGLHG
ISGFTRRLILQLLLEGEKILVSVTSEAPMKLSTIGSSNLPVMPPHPAFPLGHYHHLLYMS
TQSTVADILQQVSGTWLLLLLPNNYKGNEAGTSSLARNRELWESGMNIVMDTLSVAAGNT
AKDKRAKEASNRSQARGPIIRKTRLNADGSVLTTKSSSSNSQGSSSSMANQNYLSLSSRP
NTTLPPELTIAQLLSIVEESGVSLSEPCLYLTLRQRNKDSKEESSKSNNRNLLTLWTSID
STLEVFSSKGGLTILAKHLPLVYPDSSRPALLVEKSPTQEQSDADWVKIEHNDNVYEDLE
EGTSNGPPRAIPPTPQVPPHSLAAFGLFLRLPGYSEVLLRDRKRAQCLLRLALGVTDDGE
GGDVLSSPLAVSLPTLPFQVLKQLLDDTPPTTDDGLLLRRTSIEVGAVLLLLNCLAIFTH
QTGYNEGSEQRAGQSGSRSDDKSHLYWAKGTGFGTGSTQQSWNVEQALMRQRSEEEHVTI
LLQVLASYIGPGDQPQKELPAAFTELLSRSCLLPALSSYLRNDSVLDMARHIPLYRAVLQ
LLRAMANSSQLAPLLLPRSGKSGDPSIVSLLSSMRLCVDTYVHKINRTKNSKGKSSSKYP
EDGEQDEGLATLIPDIQESATIVQNATARLVEAIEEIAGPSPSGPEVPLKTIEQRYLEVM
KALQFDTYEMIVENPDGGFKFAISYHFESNMRSAGERNHPTRVKRLAQEAVTLSTALPLS
YSSSVFVRCDTDRLDVMKVLITGPAETPYANGCFEFDVYFPSDYPNYPMMINLETTGRRS
VRFNPNLYNDGKVCLSVLNTWHGRPEEKWNAHTSSFLQVLVSIQSLILVSEPYFNEPGFE
RSRGTSSGAQSSQEYNANVCQATAKWAMLDQIRNPCPCFKEVIHTHFWLKRHEIVAQIEG
WIRDMEMHGADRRSARTISLSALALRRHYKQLREELNKLPTPEGLEDLAEPLRPPSSPLE
MSGTPGTPSTPITHPTNFVNATPTSNNAAETSNHVHHDIDTDVEMEKMVSKVCE
NT seq 14385 nt   +upstreamnt  +downstreamnt
atggccgatgacgatccttggctgctcaaggaacaaggcttcctgaacgtcggcaccgag
tgcaagcagattatttaccacccgaacctcaatgtccttctcatcaccactgccagcgcc
caagtccatgtcttcgacgtcaactgcggcctcgtcctccagagatgtaccctctccggc
aaaacagagggaaaactgcaaggtatttatttgggtgagggagtagacaaaatattgtac
acagatggcagaggaattggagtccgcggcgactataatggagtcctgttgctggacagc
attctgcaaatgcctgtcttcaggagcggagacactattaaattagaaatgttactctcg
gaagctatactattgcatcattgtctgcgatctgtagaacttccgggagttaatcatgta
caagaagtgctgcaggaattgtctaccactattgcttatgccaaaaccagtagaaaaaaa
ggaattaaagctcaaaaatggaacacaatatgcctagagctgccgcatggagcattgaaa
ttagtatgttcaaatttggtagattatctgaaaaaacaaaataaacatatacctgcatta
cctatagcatctgctataagtgaacgtttaaatggcctactcccaggccttgctatggaa
agtggaactgtcgacaaagttttaatgttcagtgaagcagctcgcagagacactttttcc
aaatggccacacatgaattacaagtgggcattgccagaccaaatggctcaagctggcttc
taccaccagccgaattcaacgggcgaagacagagcaatgtgttttacctgtagtgtctgc
cttgtttgttgggaaccaacggatgaaccttggtcagagcacgagcgacactcgccggcc
tgtcctttcgttaagggcgagtacacgcaaaacgtgccactttcagtaacacttgccacg
gcaccggcccaagctgctggcgaaaccgtcgatgttattggtacgacgaacgttactggt
ctcttgtccacggcatccaacaacggttttatcaatgtttggaacgtgcacaatcagctt
aagagagaaatatctttctacataagtccaagtgagagcgagatatacagtagagactct
gtgcagttcgtagcgtcaaaaaccgctcctacaacatgcccgtttataccaaatctcgtc
tcggaatcgaatccactggttgacgcttacaaacccacttcgagcgcactaggcagtact
aatagcaaatttcaactaacagctttggcactcgttgacggtccaaaatctacgagcgaa
agcaagagcaccaactccagcgctggcgctacaataatgacacaagataccagctctgta
ggaggaacctcaataaggccgtgcctggtttgcggtgtatccgtaacatcgagtactgcg
ggaggcagcattggttcggtctcgggttcttcttccgctaccacagctcagcatcagctg
agaagcctggagaacgtgtgggcaacttctacggatctggcttcttcttcctcgctggtg
cgcgctatgaacagtgtcaacagtgctgcgagtagtaacagtcttgacataatgaaagtg
gcaacagccgatgatacgtgtagccctgcaaagtcccattacctcgtgctatgtgacttt
catcacaagactgctcaaccacagccggcgaagaaggatggctccaaggacacaagtaag
agtaagaaacagctttcgggcacgggaacgagcgcgagctctaatggagtaaggcaagag
agtctttatcaggagatattattgagcaatttcctgctcgaagagattaacgaggatgtg
gactctgagatggttggtagcacgcacttcgacagtatctacgcggcccctcataccgtc
ttggccactcctactgccaacggcatcttctacggcgtacccatgaatagttccattcca
acgtctagctccttcgacgccaactctaatcccatcagcccctatgtacctgaacagttc
gcgtcaacctccaaaatgactcaacttagaaagactctagatacgattaagacaaccaaa
gcggagcctgtagttatacagacgattcgcatcgaagccgcggattccctgaggatcaat
aaggtcttaacaaccaaggatggcaagcatttatttgttactttgagtcctcaaccaaat
actaatgcaaccgagacattttcaaataccaatcagatggatgtagacgacgaaaccacg
ccgaagagcttcatgtattgggaccacaatgatgtgcagtccaagccacttataaacggc
gaaacgcagaacgaggaggagtcaagcgtaaattccatccttctggtatatgcattggac
ttctcagatacggtggtaaagctcacaacggaaccagtcctcaggcgggagttaccacct
gatcaagcacccaatgattgcatattattgccgactcttgagaagggtaggctaggatcg
tcgagtctttctagtggtatgcaatatacagcgagtatggcttctgacagtctgagtgca
cacgaaccacgtggacaagtggccttagtttgtagggatggtgtggtcaggctattagac
ttgagcaatttgaaaactgtaaccgaaactaaacttgacggaaaaaaattcatttcggca
gcttattgtaccagattagaaaggttatgcgcttgtactagtgacggagcactacacttc
tttagcatgacagctgaagacgattcaaccgaggagaaagatgttgacgatttgcaaatg
atcaccgatacgagtataagcgatgaaagcgaattggcaaccccaagtacatcgacctca
cctccattaaaccaggaacacattctggcatacaaacaacatttgacatactcggatttg
cgaacattatacgatttaacgaggtttgatcgacgttctccaccgtatagtgcgacggtt
ccaccgtgctggagtgaaatgatgcaggcgcaacgtcaacgtcgatacccgcagcatctc
catcagtctgaagaccagcatcatacgcgaacttggcgtttgcaaaacgatgccactacc
tgggatgaacacatttttgaactcacattgcctcggagtgctgctggtaacgttggccac
gttgatgttcgattcagcttgcagtttccgtgtctagaacttccaatgatacaagtcact
cttctcaagcaaaatatgactggaattggaaataaatctcttctaataccagtcgacgaa
aagatagattttaaaattggtcgcgaacaaaaggctgacaatcccatcattacagaagaa
tatcaaaggcatcacaatacggaaattctatgcggacctgtcaatttgcagcgatgcatg
gatttatcagatcattcaggttgcgttacgctcaccagtcccaaattattccggacaaaa
gccaaaacgcttttagtacatattaaagcgttgattgaaccgactaaagaaggggcctcg
tccaaatcgagatctagtttattagaatcaaaaccgccaacttcgaaaaaattaaggata
gacgaagctggaccatttccgcctggagtcacagtagaaagatttgccgcaaccgcaact
aagaaattagattgttatataggttgcgattggatacatgaagtttctattactgtaaga
tctgtacttccaacaaatattccaaatgaaaagttgcaacggtgtgcaatgttggaatcg
aaaaccttcattgacaacttgctgagtgtagcatgtttgcaaacgtcagataagtcaccg
gttgttcaatcattagctttggatattttaatatgggtcgctgcaataagattaacaaga
ttacgtactggaatcgacagtactaaaacaaaagcaattcagttagaaactgttcgttgt
gtacaagaaagattaccttgtttattacgaacttgtttattccatgctggtcgaagtata
gcgcacaaatgcgtaaagatcgttgtactatgtagcgagggccttcacagtttagatgac
tcggcacctcatgcttttgaagaaactgtattgtcagttttagttacattgctacctaac
atagtgagcgtacagtgggctggttcactacgatggcttgctgtacttgtaacgagatta
ttaccattagatagaaatcatagtgtagctcaacaatgtatcaatctaattcaagaaata
tctgtggagatgtcaaaacgtgtgaatccatatcatttgttacttgccacaagatttgga
ttgtacaattctccatttgaaactgagctgtttgatatggatcctccggtatctcctaag
tcaagctctgtacctgtgacaaacacatattcctctattacagctggtgaacaacctgta
acgtctgtaacatctgcgacttcgtcgtacactcaagatgccattgatttacgagatctg
ctttctcttccttcacattcagcaggcgatctcattgtaccaagtaaactgaaagcactg
tgtgctaataacagtatgaaaggacttttagaggttgaacccttgcactttacgtgtcac
gcggcttctgacggtacaaaaatggaaaaaattgatccgagcgtcaatactgtaaccatt
ggaggtgcgctttatgactctgcggcgcctactgtgacgattgcaacatcgtctgatact
aaagtaattcaccatgcatataacttcgaggcaggatcactaggagctgacgttcaattt
aagttgatcgaccacaaattaactgatctccttagtcagtgcactaaaaatgcaccaaag
gccaactatgaagctctgtcaaagaagtcccaagatttttacacgcccgacgatcaatcc
gatagcgacgaggctagcaatacgcagtctgctacaacatccttctggactctatgtaac
gataaatccccgacgttaacttctgttctgaaagaaaagtcctcttcggtaactaatgtc
ggtacctcggcgagcaaagttgaagataccggtgcgaaaaagcgcgatgacataagtttt
ccatggggaaggttactttgttgtccaccacagcaggccttggttgttgaaaggatgcat
tctggagctcgaagatttgtaattttagattttggcgctccagttttacttaccgacttg
ataatacctgcttgcagcgacttggtctctctttctattgatatctggactagaagtgaa
gaaacagatggaattcgtcttgtggttgctggtgatattggtaataagcctttagtagtc
agtgatttgcagcctcctccagtgtgcagatttttgaagattacaaccattgggcgctat
ggcatgtccacaactcggtgcaagattcctttgggaatgttttatggacacatggttgtt
ttaccaggggaagattattcagaattgactgcttcagaaacaaatattaacaacatttct
gatccagttttacaaagtactatagaatcacaatgtaccattttgtctgcacttgctgaa
gatgttcagtgcagatttactttagctactgagcgtctaaaaggttatcttgatcctttg
ctgtgtacagaaacaccaaatgtaatacacatgcaacattatttgagtcatagcaaaaac
gctagtgatagtaaggatcagccgtcatcaaagattttgtctacttatcaagaatgtata
atgtatcaacaccaactgaacacaatacgtggagtttggcaaagactagagtcgtggaga
agcgtagaaagtgctactcaaaatacattagctagcgcttcttctgacaaattgcgtatt
cttggagaaactcttctggatatattactttatactgtttatgaaatcggtccgattcct
accgtgccaacaactttatatgaaacattcacaccgactgtatgtgaacaattattcaac
tctatatgtgttatgaccccagcaccacatttacagctctacgctgtagcacttttggct
agaatggctgggcatcaaccatggtggggaaatttccttgcaaatacattaattagtctt
tattctgcttcatccacccacatttttcctcaagacagggtatttattctgctaacattc
cttggacgcaaatcattgattgccgcagctaataaatcgtcagtagtagatgctatggtt
cgtactttaggaaggcttttagcgcctttgtccagtggtcaaacagataactcgagtaga
ctggacataacccttattggctgggttcttcttttcttatctgtgtgcttggatacaacg
gctgttcatcctacctcatccgaagacaaccacgacaagaacaaagaacaaggtacccgg
ggcttttcatcacgttgggagtttattcaaggtgaattagccatgcaaaggaaatttgtg
agctccagtagatcttctgcttctagaagctatcgtaagaaactacagaagagattaatg
catcataagcaacaattgcaagacttggaacaagcgaaaaaatctttccatacttcttca
cagacacattctatgctttccactcagagcgctactttctcgtctaagttagaacaagct
ctaaagtctcaggaacgtttttataagaaaactttaaaacaacactcggctaaacacttt
aaagacctttttagtattcgaagaaacgaattacatttgaatcgcagtcctcgatcacaa
ccccaaccaagcactagtcaagcggatccccctgaccctgaaggcgactattcaacaaat
ttgtcacatcaacacgttctaccagtggcgcgtgggcttgtcgctttattgctaaacatt
gcctcaaatgtagatatgtttttgttagcttgtaaagttgtagctaggttagttgtatct
acacgacctgcgataagtttgggtgagcttatgaccgaagatcaacttttaaaattgatc
agattagctacgggttcatctgataccgcttggtcatcgcatgctgtttgttgtctatta
caagatctactagaaggagaaaaattatatccacgaaactcggcggcgaatgaacaaagt
gtttccgaagaaccttacgatccattgtcttcagaagatgcaagagctgcagatgacgat
tcagctgctgctggtacaagcacttcttcaaatactttcggaaatgatgaaggattcgcc
gacggcgatgaagatacacaggacagtattagcgttgctccaaccaatgcatctacgtca
aaagcaagtggatttaaccttccctctttaatggaatcagatgatagtgaattcgaagaa
tttttagataatattcttgaacgaggtaaaacaatcttgaaaaagggcagtgctgtgtca
aaatatccaacgataacaagctcaggaatttcacaagcaattgatgcaagattagaatac
ggcgtggaaacgggtgtagaaatatctcttcgtagactttctgctctaggaacttacaat
ttacctctgggtataaatgctacgatcaatcctacaaccgattctactcgtcactcacaa
ccttccacatccaggcaatcgagttattctgaacgtaatcaagattcttggaattcttcg
gatccaccaccttctagtttattcatgttaaccaggtgttttgataaaatttttagtgaa
ttgtacattcagggtagtggaacaaacttggagttgattctgcaactgtggttaacatta
aaccttgatgccacgtcagaatcaaactcttccaattttgatgcctctttaactccagta
ataccgctcagttctacagcaatcactggactaatatctgcgttttcatggcacccaggc
gtttctttacgagcttggtgttatgtactgcaatgtttgacacttgctagtaatcagccg
ttgcaagcggaacaggtcgaagccgctagttgtagtactccactggatggattattaggc
ggcatggccggatgcattataaaagaacgtaacatgggtgctatgcttcttcgtcttctc
tctggcaatggtctaaatgtcgatactactaacaagcactttggaatggctggtccaaca
ttgtgtcaagctctgcaagattttcttctaagactagaaatgcgatgtgatgcagctacg
cctggaagtgcattaggaaattctttaaaggaactcttgttatgggttgtgtatcaatta
gtgcaacccgggggtgcacttgtcgctcggcgtggccccttggatgcgcaatgcaagctt
atcacttcattgcttcaattcagtttcacaaatactgatttgggcacagcaatgagtatc
tcagaatgcgttggcgagttagtatctacttatgtcagaggagccggagtcggagctcag
tgtggcggaacaactgatgccactagtcagtctggaggttttggtgggctttatgcctgc
gttcttggaagcgatgcaaggcaaggacgacctgcttcctgggatgccttagtggtggca
cttatcaaactcgtaaccaaacttgtgcaaactcctttgccaaatgcacgaaccacgaga
tctgatagtacaacagaaatggaacttggagagtcttcacaaagctcgaattccagtcta
aatgatagtcaagagaaaatgaacacgtctcaaactgacgaaagcaaagttgcagaacag
caaacttcttcgcgaactcattcgacatccaagcctcgcgtgccatgcgttgccgatact
gttctgcaacacgaacccaccatgatgcgactcttaggatcgcttggacatagctctggt
tcgtcattagctatgcttttgggcgaaacatcaagtacaaatgcaacgactgaactgact
gctcctccttccattcctgatgctactttccagttactttgtacactgactaaaaaagca
agcaatccagttcttgtcttgaatccagtttaccaatatctcgcttcgtcgtgtagacag
ggaatatccgatcgccacatggacgtgatgcaactctcagaaccacttttatggttcatt
ttacgagtacttgacaacgaagcttcattgtccgtttttacgtccatgggtggtgtaaag
gttttgtgtgagaatcttgtcaagtccagcaagagccgcagtggcaatgggtcaaattcc
ccaggtgtaatagctctagtgatgcagcatctgtcaaactcaacaagcttaacacctgtt
gtatcgagcagcagtagtaaaaaatcggctaatgcgctggaatttttcgaagatggattg
ctgaatttcgcacctcttggaactgtgtcttggcttcatccaacagcacaaccagcggac
gtgctcattcaaagtgcaacgcctcataggcgagccagaacagctgcatggtcttaccac
ttctatcctgatgaagcctgggtggatttgacaattacactaccatgcgcgattttatta
aaagaggtcgagttacaaccacacttggcatcactctcaacttgtccatcagctgtagct
cttgagatttcacgtgaaggaaatactgctttaagtccaatttgcccgccaatgccaacc
gctggtctaacattcattcgtttgacactgtctcagcctgaagttgcaactgccgttctt
gtaagattgtacaaacctcgcgattcgacaaatatcagtctcagtcaaattcgcttactt
gggacgaccgcattcggcgatcctaaatcaagccatgatattattgatgaagagcaactt
actaaaaccagtttgggctggctgcgacttgttcaccaatgtttgtctgttagcacagta
aatagcaatttaactgcccaagttttgaattccgcagcttcagtggacggtataattgaa
tcgtgttgcaatttgttactactaccagctccatcgctctttacaccaaatttagagaga
gtactacttcagcttggtttacactcttgcgaacttggtcttcgcttgatcaatctttta
ctcaacaatagaactgctcctcttttacaaggctctgtattgagtcaagaaacaaccaca
attcagatggtggttgagttattggagcaactgtgttcagctcaagactctaacacaaaa
actcgtatgtctgctgttctaaattggctgtacaccgtggcaaaatcgtctgcgtcagac
aatgagaataacagttcctttggaatgacgaacctagcaactcctccagctgtttatatt
cattgcatctctactatcatttggaaagcggctaaactcgaaaatcttaattacgattta
aaagaactggtcaccgaagatttatttgatgcactgtatcagtggacattaattttgaaa
acccactcggctcttaagcaagcgatcgacgctgttctatgcgcattttgctgcgtgaag
ccagaattcttccaattattactgcaaagagttcagattctagtgccaaacatgtcaaac
gaacaggcaggtgcgtcgatttctgatgatcgtaaagaaagcgagggtcagaccgacgat
ataaagagtgtagctgatttgaacgactggtatgcacatcttgctcagtcacagtttaag
cgcctatcgttgacggaaggacaactactatcgatagctgcggcagcgcgctcaactcct
ggtatctgccaactgctcaattctggattaacaactctcttaactgcttgtatagtggag
tttgcaattctggaaaaagcaaaacaaactcatgaacatcaaagacaacaacaacaacat
caacaccacgaggcggataaattaacaacagaagaaccaagttcgccttcatcagtcgac
aaagatgcagcaagctgctctggtatgaccgacagtgataaagcaggcgaaagtacaaca
caagggaacaaaatcgaagggctcgatatgaatgaacctgaaagtatagcaatcgtactc
gaatttctatctttgatatgttccgaaggcaaaatgcgggattggcttggcaaagatggt
agtggattttggttaccgttacttactttattaagtgacagaccaattgagaatccatca
acatcttctttacgctgttcaaaaacgagcatatcgtatgcgaaattggaggctgccatg
attaaatttttgtcaaaatgctgctggtgtcatccagctaatcaaaaactattagctgaa
cttttaactgaagtgataatacaacaaaaaacacctgccggttcgcgaggtttacatgga
atttcaggattcacgcgaaggcttatccttcaacttttgctggagggcgaaaaaattttg
gtatcagtcacatctgaagcacctatgaaactgtcaaccattggcagcagtaacttacca
gtaatgccaccacatccagcctttccacttggtcattatcatcatttactgtacatgtct
actcaatcaacggttgcggatattttgcaacaagtttcaggcacttggctgcttttgctg
ctccccaataattataaaggaaacgaagcaggtacaagcagtctggcgcgtaaccgcgag
ctgtgggagtccggtatgaacatcgtcatggacactctcagcgttgcagccggtaatacc
gctaaggacaagcgagccaaagaagcttccaataggtcgcaagcacgaggtcctattatt
cgaaaaacacgtcttaacgcagatggttctgtattgacgactaaaagttctagtagcaat
tcccaaggaagttcaagtagtatggctaaccaaaactatttgagcctttcatcaagacct
aacactacactaccgccagaattgactatagctcaattactttcaattgttgaagaaagt
ggagtttcgttatcagaaccatgtttgtacctaacactacggcaacgaaataaagattca
aaagaagagtcgtcaaaatcgaataatcggaatttgttgaccttatggacaagcatcgat
agtaccttagaagttttcagttcgaaaggtggattaactatacttgcaaagcatttacca
ttagtttatccagactctagtcgaccggcacttctcgttgaaaaatcacctacgcaagag
caatctgatgctgattgggtaaaaattgagcataatgacaatgtctatgaagatcttgag
gagggtacaagtaacgggccaccaagagctattccaccaacacctcaggtgcctccacat
tctttggctgcgtttggtttatttttgcgacttcctggctattcggaggtactgcttagg
gatcgtaagcgagctcaatgcctactgcgtctggctcttggcgttaccgatgacggtgaa
ggcggtgatgtacttagttcaccgctagcagtttcattaccaactttaccttttcaagta
ctcaaacagcttctcgatgatacaccgccaacgacagatgatggtcttcttttgcgacga
acctcaattgaagttggcgccgtattgctgttgcttaattgtttggctatttttacacat
caaactggatataatgaaggttcggaacaacgtgcaggtcaatctggaagccgaagcgat
gacaaatctcatctatattgggccaaaggcactggttttggcactggttcgacgcagcag
tcttggaacgtcgaacaagctttaatgcgacagcgttctgaagaagagcacgtaaccatt
cttctgcaggtgcttgcaagctatattgggccgggcgatcaacctcagaaggaactacca
gctgcttttacagagttgctgtcgcgatcttgtttgttgcctgctctgtcttcatatcta
cgcaacgactccgtccttgatatggcacgccacataccactctaccgcgctgtactccag
ttactgcgtgcaatggctaattccagtcaattggcgccgttgttgttaccgaggagtgga
aaatctggcgatccctcgatcgtttcactgctctctagtatgaggttgtgcgttgacacg
tacgtgcataagataaacagaacaaagaacagcaagggcaagtctagttctaagtatccc
gaagacggcgaacaagatgaaggtctagctaccttaatccccgacatccaggaaagtgca
acgattgtacaaaatgcaactgctaggttagtggaagctatcgaagagattgcggggcct
agtccatcaggtccagaagtacctttgaaaacgattgaacaacgttatcttgaagttatg
aaagcactgcagtttgacacgtacgagatgatagtcgaaaatccggatggtggattcaag
ttcgctatttcgtatcacttcgaatcaaacatgcgctcagcaggtgaacgcaaccaccct
acacgcgttaagcgtcttgctcaggaggctgttactctttcgaccgctttgccgctatcg
tacagcagtagcgtatttgtgcggtgcgataccgatcggttagatgtaatgaaagtcctg
ataactggaccggcagaaacaccttatgccaatggctgctttgagttcgatgtttacttt
ccatcagactatcctaattatccaatgatgattaatcttgagacgacgggcaggcgttcc
gtgcgcttcaatccaaatttatacaacgacggtaaagtatgcctcagtgttttgaacaca
tggcacggtagaccagaggaaaagtggaacgctcatactagcagctttcttcaggtttta
gtatccattcagtcgttaatcttagtatccgaaccgtatttcaacgaaccaggctttgaa
cgttcgcgtgggacgtctagcggtgcacaatctagtcaagagtataacgccaacgtttgt
caagctactgcaaaatgggcgatgcttgatcagattcgtaacccttgcccatgtttcaaa
gaggtaatacacacccatttctggctcaagagacacgaaatagtagcacaaatagagggt
tggattagagacatggaaatgcatggagcagaccgacgatcagctaggactatatcattg
agcgctttagcattaaggaggcattacaaacaattgagggaagaactgaacaaactgcca
acgccagagggactagaggatctagcagagcctctgcgcccaccaagttcgcctctagaa
atgtctggaactcctggcaccccaagtacgccaataacacaccctaccaactttgtcaac
gctacaccgacgagtaataacgccgctgaaaccagcaatcacgtgcatcatgatattgat
acagacgtcgagatggaaaaaatggtctcgaaggtctgcgaatga

DBGET integrated database retrieval system