KEGG   Nasonia vitripennis (jewel wasp): 100117646
Entry
100117646         CDS       T01081                                 

Name
(RefSeq) single-stranded DNA-binding protein, mitochondrial
  KO
K03111  single-strand DNA-binding protein
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi03030  DNA replication
nvi03430  Mismatch repair
nvi03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    100117646
   03430 Mismatch repair
    100117646
   03440 Homologous recombination
    100117646
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:nvi03032]
    100117646
   03400 DNA repair and recombination proteins [BR:nvi03400]
    100117646
   03029 Mitochondrial biogenesis [BR:nvi03029]
    100117646
DNA replication proteins [BR:nvi03032]
 Prokaryotic type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    100117646
DNA repair and recombination proteins [BR:nvi03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     100117646
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    100117646
Mitochondrial biogenesis [BR:nvi03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    100117646
SSDB
Motif
Pfam: SSB YdfZ
Other DBs
NCBI-GeneID: 100117646
NCBI-ProteinID: XP_001607466
NASONIABASE: NV15686
UniProt: A0A7M7GHE6
Position
3
AA seq 141 aa
MMLNKIFVNTCKQIRGINYVSARAFTANDSNKIEKSLNQVTLLGRVGGEPQKRGNEEHPV
VTFSLATHINYKYEGGDLMQKTDWHRIAVFKPNLRENVYNYMRKGQRVMVNGRLSYGEVK
DEDGNMRTATSIIADDIIFFQ
NT seq 426 nt   +upstreamnt  +downstreamnt
atgatgctgaacaagatctttgtcaacacgtgcaaacaaattcgtggaattaattatgtt
tccgcacgtgcatttacggcgaacgactcgaacaagattgaaaaaagtttgaatcaagtc
acacttcttggaagagttggtggtgaaccacagaagcgtggaaatgaagaacatccagtt
gttacattttctcttgctacccatattaattataaatacgaaggaggtgaccttatgcaa
aaaactgattggcacagaatagctgtgttcaagccaaacttaagggaaaatgtatataat
tatatgagaaaaggtcagcgtgtcatggtaaatggtaggctgagctatggagaagtcaaa
gatgaagatggtaatatgaggactgcaacatccattatagctgacgatattatatttttc
cagtaa

DBGET integrated database retrieval system