KEGG   Nasonia vitripennis (jewel wasp): 100117683
Entry
100117683         CDS       T01081                                 
Name
(RefSeq) putative fatty acyl-CoA reductase CG5065
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    100117683
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100117683
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     100117683
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase Polysacc_synt_2 3Beta_HSD GDP_Man_Dehyd RmlD_sub_bind KR
Other DBs
NCBI-GeneID: 100117683
NCBI-ProteinID: XP_008205703
NASONIABASE: NV15377
UniProt: A0A7M7IY60
Position
1
AA seq 517 aa
MATTMPGVGYTSVKEFYRDRSIFITGGTGFMGKVLVEKLLRSCPGIKNIYLLMRPKRGQG
VQQRLQELLNAPLFEKLRQDCPHELLKIVPVAGDITEPELGISEADQELLIRCVSVVFHS
AATVKFDEALKLSVTINMLGTKRLVQLCHRMHNLEALIHVSTAYCNCDRTDVEEIIYPAP
HDPEQIISCTTWMDDSLVEELTPKLIANRPNTYTFTKALAESMLRTECGSLPVAIVRPSI
VLSSFREPVAGWVDNWNGPTGIIAAAGKGFFRTMLCHEDKVADLVPVDIVINLMIVAAWR
TATHRTDQITIYNCSTGQQNPITWKHFVDLSFKYSRMHPTNGAIWYPGGRCRSSASLNRI
CVAFQHIVPAYALDLLANLRGSKPIMMRVQAKLHKAAKCLEYFSTQQWNFKDENVKRLGQ
QLSADDRQTFMFDVKQIDWPAYLENYILGIRQFILKESPETLPAARSHITRLYWLHKAVQ
VGTVLLVMRLLLSHSTWARGAWFSLLSFVLRMCRMIV
NT seq 1554 nt   +upstreamnt  +downstreamnt
atggcgacgacgatgccgggggtcggctacacatccgtcaaggagttctaccgggaccgc
tcgatcttcatcaccggcgggaccggtttcatgggcaaagtcctcgtcgagaagcttctg
aggtcctgtcccggaatcaagaacatctacctgctcatgaggcccaaacgcggccagggt
gtgcagcagagactgcaggaattgctcaatgctcccctgttcgaaaagctccgacaagac
tgtccgcatgaattgttgaaaatcgtgccggtggccggggatattacggagccggaactg
ggcatctcggaagccgaccaggagcttctgatacgatgtgtctcggtggtcttccactcg
gctgccaccgtcaaattcgacgaggccctcaaactgtccgttaccatcaacatgctcggc
acgaagcgtctcgttcagctctgccatcgcatgcacaatcttgaggccctgatccacgta
tcgacagcgtactgcaactgcgaccgtaccgacgtggaggagataatctacccggctcct
cacgatccggagcagatcatctcctgcaccacgtggatggacgacagtctcgtggaggag
ctgacgccgaagctcatagccaaccggccaaacacctacacctttaccaaagctctggcg
gagagtatgctacggaccgagtgcggcagtctgcccgtcgccatcgtcaggccgtccatc
gtactatcatccttccgggagcctgtggccggctgggtcgacaactggaacggcccgacc
ggtatcatcgccgccgctggcaaaggtttcttcagaacgatgctgtgccacgaggataag
gtcgcagacctggtgccagtggacatcgtgatcaacctgatgatcgtggcggcgtggcga
acagcgacgcaccgcacggatcagataaccatatacaactgcagcaccggccagcagaat
cccattacctggaagcactttgtcgacctgtccttcaagtacagtcgcatgcacccgacg
aacggagcgatctggtatccgggcggccgatgccggagctcggcgtcgctcaaccgcatc
tgcgtcgcgttccagcacatcgtcccggcgtacgccctcgatcttctggccaatttgcgc
ggcagcaagcccatcatgatgcgcgttcaggcgaagctccacaaggccgccaagtgtctc
gagtacttcagcacgcagcagtggaacttcaaggacgagaacgtcaagcggttgggacag
cagctcagcgctgacgatcggcagactttcatgttcgacgtcaagcaaatcgactggcca
gcctacctcgagaactacattcttggtatcaggcagttcatactcaaggagagcccggag
acactgccagcagctcgctcacacatcacgagattgtactggctgcacaaagcggtccag
gtgggcacggtgctgctcgtaatgcggctcctgctgtcgcatagcacctgggcccgaggg
gcctggttctccctcctgtcgtttgtgctgcgcatgtgccgcatgattgtttga

DBGET integrated database retrieval system