KEGG   Nasonia vitripennis (jewel wasp): 100117860
Entry
100117860         CDS       T01081                                 
Symbol
faa
Name
(RefSeq) fumarylacetoacetase
  KO
K01555  fumarylacetoacetase [EC:3.7.1.2]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00350  Tyrosine metabolism
nvi01100  Metabolic pathways
Module
nvi_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    100117860 (faa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:nvi04147]
    100117860 (faa)
Enzymes [BR:nvi01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.2  fumarylacetoacetase
     100117860 (faa)
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100117860 (faa)
SSDB
Motif
Pfam: FAA_hydrolase FAA_hydrolase_N
Other DBs
NCBI-GeneID: 100117860
NCBI-ProteinID: NP_001164364
NASONIABASE: NV12888
UniProt: A0A7M6UW53
Position
5
AA seq 417 aa
MKSFIEYSPQCEFPIQNLPYGVFSTADNPKKRIGVAIGDQILDLFAIAHLFTGPLLATKQ
DVFRQESLNDFMSLGRPSWLEARHTLQNLLSVENQTLQQPDARSKVFVAQNKATMHLPAK
IGDYTDFYSSIHHATNVGIMFRGKDNALMPNWKHLPVGYHGRASSVVVSGTPINRPQGQT
LPVEGADPVYGPCKLMDFELEVAFFVGPPTQLGDTVQATKAQEHIFGFVLMNDWSARDIQ
KWEYVPLGPFGAKNLGTTISPWVVTMEALEPFKVANMEQDPKPFPYLQHANSCNFDIKLE
VDLKAPSGVTTTISRSNYKYMYWTAQQQLAHHTVTGCNLNAGDLMASGTISGETADSYGS
MLELCWKGTQPIPLKDGTTRKFLQDGDEVIIRGYNDVDGYRIGFGNCAGKLLPVKPQ
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaagtcttttatcgagtattcccctcagtgcgagtttcccattcagaacctgccctac
ggagttttctccactgctgataacccaaagaagagaatcggcgtagcaatcggcgaccaa
atcctagatttgttcgcaatagctcaccttttcactggaccactgctagccaccaaacag
gatgtcttccgtcaagaaagcctcaacgatttcatgtctctcggcagaccatcttggctg
gaagccagacatactttacagaatctcctgtccgtcgagaatcaaactttacagcaaccc
gatgcccgatccaaagtcttcgtggcccagaacaaggcgacaatgcacctgcccgctaaa
attggagattacacagacttttattcttccattcaccacgcgacgaacgtcggaattatg
ttccgtggaaaagacaatgccctcatgccaaattggaagcacctccctgtaggctatcac
ggcagagcctcttctgtagtagtctcaggtaccccgatcaatcgtccacaaggtcaaact
cttccagtagaaggtgctgatccagtctacggtccctgcaaactcatggacttcgaactg
gaggtcgccttcttcgtaggtccacctacccaactcggcgacacggtccaagccacaaag
gctcaggagcacattttcggcttcgtgcttatgaacgactggagcgcaagagacattcag
aagtgggagtacgtgcctttgggtccgttcggagccaagaacttgggtacgaccattagc
ccttgggtggttaccatggaggcactggagccgttcaaggtagcgaatatggaacaggac
cctaagccgttcccctacttacagcatgcaaattcgtgtaactttgatatcaaactcgaa
gttgacctgaaagctccatctggtgtcacgacgaccatttcccgcagcaactacaaatac
atgtactggaccgcgcaacaacaattggctcatcacaccgtcaccggttgcaaccttaat
gctggtgacctgatggcctctggtaccatcagcggtgagaccgctgattcgtacggttcg
atgctcgagctttgctggaagggtactcaaccgattcccttgaaagacggaaccaccagg
aaattcttgcaagacggagacgaagttatcatccgaggttacaatgatgttgacggatac
aggatcggtttcggtaactgtgcaggaaaactgttaccggtgaaaccgcaataa

DBGET integrated database retrieval system