KEGG   Nasonia vitripennis (jewel wasp): 100118006Help
Entry
100118006         CDS       T01081                                 

Definition
(RefSeq) titin
  KO
K12567  titin [EC:2.7.11.1]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:nvi01001]
    100118006
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:nvi04131]
    100118006
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:nvi04812]
    100118006
   04147 Exosome [BR:nvi04147]
    100118006
Enzymes [BR:nvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100118006
Protein kinases [BR:nvi01001]
 Serine/threonine kinases: CAMK group
  MLCK family
   100118006
Membrane trafficking [BR:nvi04131]
 Others
  Actin-binding proteins
   Others
    100118006
Cytoskeleton proteins [BR:nvi04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Others
     100118006
Exosome [BR:nvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100118006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 Ig_2 ig Titin_Ig-rpts V-set C1-set C2-set_2 Ig_4 Ig_5 C2-set CreA
Motif
Other DBs
NCBI-GeneID: 100118006
NCBI-ProteinID: XP_008212279
NASONIABASE: NV17131
Position
1
AA seq 4822 aa AA seqDB search
MRRQQSWDMQKQQYSQERTETQVTRQQITQQRVQGEMIVQTTPTVPTFSGRPGDPSPPVF
EQIFKNARFAQGGNAIFEGRVKGNPKPVVSWTHKGAPLLETHKILMSYDDKTGNVKLQIN
QIGPGDEGEYTCHAKNQYGEGICSVYIQPEGFGPPPIQQQGSYKKEVSRSYQQYTNGSNI
TTTEDFKVDIFEYRILRETEFRESITRRYVGESDSQITTVADRSLGPVAPPQITQKPRSS
KLSEGSEAVFSAKISGNPKPRLTWFKDGQRLRGSQHVETIYSNQTATLKIHKVSSQDTGH
YSLLTENPQGCTVSSAYLAVESNDQVDHAPVQSIQSKEVITTFQSEAPIETPESGKILAP
NFVRTCTDRDVTEGKMTRFDCRVTGRPYPEVTWYINGFPVANDATHKILVNESGSNSLMI
TDVSRSDGGVVTCVARNKAGETSFQCNLNVIEKEQVLAPKFVERFTTTTVKEGEPVSFTA
RAVATPPPRITWQKDGVPITLGPDVRITTDGSGASTLDIPFSKLTDAAWYQCTAQNVAGS
TATRARLFVESPKGAVPEPPRRLNLPRPTKVIEPEPAPGPEVIYLRHVERAKPYLPPSEE
DRIYPPPRFIIPLRDAHQIEGGRIHFEARIEPVGDPTMRVEWYINGRAIDASSRATSVFR
FGFIALDLISIVMEDSGEYLCRVVSSTGVAESRATLSVTPRATIEQTSQNPDSLRYIQQL
EDYSKYQRQESVEETSSQRPVFIRPLQDLGELQEGRNAHFEAQLTPVSDPTMKVEWYKDG
RPITASSRITTIFNFGYVSLNIMHLRSEDAGSYTVRALNRSGEAISTASLRVFARTTITA
DLGIPEQQRYIEAAEELEAYQQAAHQKYVQEQPEKIVPPVFKTPIKDQISIREGGFAHYE
AQLEPVGDASLRVEWLKDGRPVEASSRITTFFNFGYVALTIKYVTIHDVGIYTCRAYNRA
GEAHTTAQLSVITKNDIIYDSQHPSGLQKIQSLEDSSRYSRKVEEEKIIKQPPRFLGPLK
GTNKIVEGQRAHFEARVEPQSDLTMKIEWYHNGKPITAANRIQTYHDFGYVAIDILQVRP
EDAGTYTVVARNNLGEAKLSATMMVETRSSIDTSSMHREAYEKTQRFENAPFVEPQYYIE
EISKSKPIFVQPLSDPPPVSEGKNIHLECRLEPMGDPTMRVEWFQNGKPVTVGSRFRTYY
DFGFVALDIIHTSALDAGEYTVRATNHLGSAHTSACVRVIGRSDVVTDTQNEQSLEQIQM
LEDSSRYRRTQQEEVTVQQAPQFTRPLHNIETVELTNVHLECRLQPVGDASMRVVWLVNG
KPVKTGHRFRPSYEFDYVALDILGVYPDDSGVYTCQAYNQLGEAITSCSVRVHAKKDLIL
KSQHPEGLERIQYLEDASKYKRHELVDEVVNVKPRFITHPKNQENLREGHNAHFECKLEP
VTDSNLKVEWLKNGRPIQIGHRFRPIHDFGYVALEVIGVIAEDSGVYTCRAENLVGRDEV
NCTLNCRSTAQILTDTQNESGLEQIHYLEDRSKYQRREDVEEITTQAPIFTTSLNNVEIK
EGQRAHFECRLIPVSDATMKVEWFHNNLPVKAGSRFVETNSFGFVALDIMYAYPEDAGTY
TCRARNAIGEAITSATAVVHSKKSIYLETQNEEALQKVRQLEDHSRYQRKTVQEETVSQA
PVFTMPIKDLQVAENQAAHFEARVIPVGDSKLVVQWLRNGVPISASNRITTMHDFGYVAL
NMKYVTPEDAGTYTCRAVNDLGEAVTSATLFVQSKAALQFESQHEGALSKLQALEDTNKY
QRREEEDIVVNEKPRFTVQLNGPTNLVEGQSAHYECRIEPYPDTNLKVEWFHNGKPLSTG
HRYRTAYDFGFASLDVLSVYAEDSGTYTCRATNKLGQEQSSINLDVKSRASIIRETQHEG
ALKKIQYLEDDSRYKRTDREDVIIAEKPKFGRPLKNIEHLPEGKSAHLEATLTPVNDPTM
VVEWYRDGRPIPQGHKFKTTYDFGYVALDIMYAYPEDSGTYMCKARNAVGEAVTTCVISV
DCKQGLYLDTLDAQRLEKIRQLETVEVKHVVEKEIVHQKPVFLTPLNNLDHLKEGEHAHL
ECRVEPINDANLKIEWFVNGKAVKTGHRFRTTHDFGYVALDILYSYAEDSGTYMCKATNL
AGEAVNTCTIKVGSHRSLILDTQHPDGLEKIRELEAQGRPARLEVEEPPVFPPKFVTELR
GTTEIYEGQTAHFECQIEPLHDANLRIEFFHNGKPLPSASRFHVTFDFGYVALDISHAVP
EDAGQYSVRAINALGQCVSSIELKVIPKDNIILESQRPEGLDKIRELESLQPWKRPDVPE
PQTRQRPVFTQPLQNIDAIAEGQTAHFECRLIPVGDPTLKVEWFRNEKPLETSSRITKVH
DFGYVSLDITHVREEDEGVYMCRASNPLGEAVTTASMKIQSKANIQLDTQHPESQRKIAR
LEADKVPTRAEEPEKVFDKPIFTQLLTGPTELWEGQIARYECRVVPVGDASLRFEWYVNG
VELKMGSRYHVNHDFGFVTLDIMKVIPEDSGVYTCKAINNAGEAVSSISLKVKARSAISG
DAIQPDAWKKIQLKEAEMNKVPEMFVDTTPQQAPVFTTHLKSYDKLVEGQHVYLEAQVEP
RADPNLRVEWFKNSVPLQIGTRLKSTFDFGLVSLSINGLRPDDSAIYTCKATNLLGEAVS
TSSLKIADRHWLLGDTLHPDALSKISALEQPPEGTKEQPEPTYEEPVFISHLNNVECTEG
DNVHFECNVEPSKDPTMKIEWFLNGKPLPYGARYKSTYDFGYVALDLNHAYEEDSGVITV
KATNSKGSAQTSGTLKCTSKQSIYLQTQHPQGQAGLEKVKEVDDAYASKAKRSDSGPEKE
YPKPIWTVPLQPEFKLGEAEPLHLEGQVEPKDDPNLKIEWYFNGKILQHGARFKMTCDFG
FVTLDLTDVYDRDSGIYTCKAYNKAGEAFTSSTIYCSTKENVIERSQHPKGKEGLEAIQD
LEESLRKQPGAAPESEGGHAPSFTSQSDNLSNLSEGELAHFEATLIPTGDQTMVVEWFFN
ENQIEASHRIRTVYAFGTVVLEVLGTKIEDSGTYTCRATNKWGKAEISLTLECIDKSMGQ
KPRFTTQIQSLEGLKDNQSAHFQCTLIPVGDPNMKVEWFHNGQPLRHSSRFKMVSDFGFV
VMDIAGVMSHDSGEYVCKASNKYGEDYTKATIKCFGKSGVYLDSLQPDSLAKIRELEAFT
GEQYAAPVAPVAEPPKFITQITDITKLVEGQSAHFEARLTPVTDPDLKIEWYYNGKKLPQ
GHRYRTFHDFGIVILDILYCYEENSGEYECRAVNKYGQDSTKATLRCLSKANLILESQLP
KGMEGGLEKIQTLEDAMIKTREEKVTETKGKAPVFTVPLSNLDGLREGESAHFEARLTPT
DDPKLKVEWFWNGKPLRTGTRFRTFCDFGFVILEISPIYPEDSGEYSCRATNDYGEAVTT
CSMKCTGKRSIILESQLPKGMEGTIDKIAELEGLGAEPGQPSPDDDTGKPPEFITTPSDL
TLSENSLAHFECRLQPVNDSSMRVEWFHNGKPLLAGSRVKTIYDFGFVILEVANCYQRDS
GLYTCKAVNRHGEATVNCKLQVRGRQGIILEPQLPNNFKTGTESIQKLEESLYKKDEILP
EEEKPSPPRFIVELKNIEVNESESSHFDCRVEPTGDSTMRIDWYHNGRPFATGSRVHQIN
DFGFISLDLSYTYARDSGEYVCRATNKWGSAITKATITCTSKKSIDFDSQLPSGMSGEKL
KELERGPVSVAPPPEAPRQPPRFITQIKSFTVDENEPVRFECQVEPKDDPNLRIEWYRNG
KLIPAGHRYRTVYDMGFVSMDILYVYPEDSGEYVCKAINDLGEDTTRASVSCKQQPSIIL
QNQVPKGMKKSETLMQMEATIKKYTSEVHLTEDDLYDAEKKQPPRFVTQITDQVDLVEMN
STKFECQLAPVGDPNMRVEWFLNGKPLLHKNRFNTIYDFGYVALSFGWVYPEDSGEYVCR
ATNLYGMDETKAIIRTAGKPGIIYDSQLPKGMKSIEKIREMEAAWQVVPEEETEVEKVRS
PPTFVSKPEPFTVEEGDWSRFCCRVTGHPRPRVMWLINGHTVVSGSRYKLTYDGMYHLDI
PKTRQYDNGKVEVIARSSVGEARTETTLTVKPRSDDYRGVLKTSPKPWYDYELTQYQAER
QETELERVFDERTHSLSQGTNIATEHLGQKVIKEPETEWQKSIKSKKNEDYYTKLMSLEE
EQILKESRLRESSHQFAIPGDKIVNNSIAKGMAQKYHENLETQPQEPAQPPPKISKKFTT
QVDIDSQQHKGPKYPPEPSESTVHGREVHVAKQKQTQKEVKDDVEITRKITATETTEVEH
KAKTQERVVQGQVKPSKPPVFTKKIQPCRAFEQEQAKFEVEFDGDPLPTIKWYREDFPII
NSADLQIYTFSTKSILVIRQVFMEDSGVFSVIAENRGGKAKCSANLVVEERRRQPGRGGI
IPPSFITTVQSTTVTSGQLARFDAKVTGTKPIDVYWLKNGKKISPDIRYKTLEEDNIYTL
LILESVVEDTGKYECVAINSAGEARCEAECIVRQPQQPTKTAKPSPSDIEKVPTVLQPLR
DQTIKEGTSVAFSCRISGKPIPTIQWKKADKIIKPSKYFQMQKEVDLCTLRISEAFPEDE
GVYKCIAKNSAGEVTTSANLKVLAPDQTDVLPKLTPLKDQIVLEGQPAQFKTQVSPAKPK
PTIQWYREGALIPESPDFQMIHEGNNAVLLIATTYEEDTGTFTCRATTSAGTVESSAKLI
VKTQERRFFAHAHYWNPVKIQP
NT seq 14469 nt NT seq  +upstreamnt  +downstreamnt
atgaggcgccagcaatcatgggacatgcagaagcagcaatactcgcaggagaggaccgag
actcaggttacgaggcagcagattacccagcagagagtccaaggcgagatgatcgtccaa
actacgcccacagtaccaacattttcgggtagaccaggtgacccgtcgccaccagtattc
gaacaaatcttcaaaaatgcacgatttgcacaaggtggcaatgctatattcgagggtcgc
gtcaagggtaatccaaaacccgtcgtgtcttggacccacaagggcgcacctctgctggaa
acacacaagatcctcatgtcttacgacgacaaaacgggtaatgtaaagttacagataaac
caaatcggaccgggagacgaaggagagtatacctgccatgccaaaaatcaatatggagaa
ggcatttgctctgtatacattcaacctgaaggttttggaccgccacctattcaacaacag
ggtagctacaagaaagaggtttcgcgaagttatcaacagtacactaatggcagcaacatc
acgacaactgaggactttaaggtcgacatctttgagtacaggattttgcgtgaaacagag
ttccgtgaatcgatcacccggcgttacgtcggtgagtcagactcacagattacgacggtg
gctgatcggagtctcgggccggttgcaccgccgcaaatcacgcaaaagcctagaagctca
aagctttcggaagggtccgaggctgttttctctgccaagatatcaggaaatccgaaacca
aggttgacatggttcaaagatggtcagcgcttgcgcggatcgcagcacgttgaaacgata
tactcgaatcagacggccacgctcaagattcacaaagtttcatctcaggacactggacac
tactctcttctaacggagaatccacaaggctgtaccgtcagctctgcttacctagccgtc
gagtccaatgatcaagttgaccacgcgccagttcaatcgatccagagcaaggaggtcatt
acgaccttccaatctgaagctcccattgagactcctgaaagtggaaaaattctcgctcct
aattttgttcgcacctgcactgatcgcgatgtcactgaaggaaaaatgacgaggtttgac
tgccgcgtaactggacgcccataccccgaggtcacgtggtatatcaacggtttccctgta
gccaacgacgcgacgcacaaaattctggtcaacgaaagtggtagcaactcgctcatgata
acagatgttagtcgatctgacggtggagttgttacgtgcgtggctcgaaacaaggctggc
gaaacgtccttccagtgcaatctcaacgttatcgaaaaagaacaagttctggctccgaaa
ttcgttgaaagatttacaacaacaactgtgaaggaaggagaacccgttagttttacagct
cgagcagttgctactccgcctccccgaatcacttggcagaaggatggcgtgccgattacg
ctcggccccgacgtgcgtatcacaacggacggcagcggagcctcaactctggatattcca
ttttcaaagcttaccgatgctgcatggtaccaatgtaccgcacaaaatgttgctggctct
actgccacccgagcacgcttatttgtcgaatcaccgaaaggagcagtccccgaaccacca
agacgcctgaacttacctcgaccgacgaaagtcatcgaacctgaaccagcacctggcccc
gaagtgatctacctaagacatgtggaacgagcgaaaccatacttaccgccgtctgaagag
gatagaatttatccgccaccacgatttattataccattgcgtgatgctcaccagatcgag
ggtggacgtattcacttcgaggccagaatcgaaccggtgggagaccccactatgagggtg
gagtggtatatcaatggaagagccatagatgcgagctcccgagcgacttccgttttccga
tttggattcattgctttagacttaataagtatagtcatggaagatagcggcgaatacctt
tgccgcgtagttagctcaacaggagtagctgaatctcgagccaccctcagtgtgacacca
cgtgccacaatcgaacaaaccagccaaaaccccgacagtcttcgttatatccaacagctc
gaggattacagcaagtaccaaaggcaggagagcgttgaggagacctcttctcagcgacca
gtcttcatccgaccgctccaggatctaggagagctacaggaaggacgaaatgcccacttt
gaggcacaactcactcctgtaagcgatcccacgatgaaagtggagtggtacaaggatgga
agaccaatcacagccagttcaagaatcactaccatcttcaacttcggatacgtctcgctt
aatattatgcacctacggagtgaagatgcaggttcttacacagtgcgggctttgaatcgc
tcaggagaggccatcagtacggcgtctctgcgtgtctttgcacgtactactattactgcc
gatctcggcatccccgagcaacaaagatacatcgaagctgccgaggaattggaagcttat
caacaggctgcacaccaaaaatatgttcaagagcagcctgaaaagatagtcccaccggta
tttaaaacacctatcaaggatcaaattagtatccgagaaggtggattcgcacattatgaa
gctcaactcgaacccgtcggagatgcttcactccgcgttgaatggttgaaggatggacgt
cccgttgaagctagttcacgaattacaactttcttcaactttggatatgttgccctcacg
ataaaatacgttacgatacatgacgttggaatctacacttgtcgagcgtacaatcgtgct
ggggaagcgcatacaacggcacaattgagtgtcatcactaagaatgatataatttacgat
agtcaacatccaagcggactacagaaaatacaaagcttggaagattctagtcgatactca
cgtaaagtagaagaagaaaagataatcaagcagccaccaagattcttgggaccattgaaa
ggcactaacaagattgttgaagggcaaagagctcactttgaagctcgcgttgagccacaa
agtgatctcactatgaagatcgaatggtaccacaacggcaaaccaatcaccgctgctaac
agaattcaaacataccacgactttggttatgttgctattgatatacttcaagttcgacca
gaagatgcaggaacttacacggttgttgcaagaaataatttaggagaagccaaactgtct
gccactatgatggttgaaactcgctccagcattgatacaagtagtatgcatcgtgaagca
tatgagaaaacgcagcgcttcgaaaatgctccgtttgttgagccgcaatattacatagaa
gagatatcaaaatcaaaaccaatttttgttcagcccttgagtgatccaccaccagttagc
gagggtaaaaacattcacctcgaatgtcggttggaacctatgggtgatccaacaatgcgc
gttgaatggttccaaaatggtaaaccggtgactgtaggttcaagatttagaacatattat
gactttgggtttgttgcacttgatattattcacacaagtgctctggatgctggagaatac
accgtacgcgctactaatcacctaggatcggcccatacctcagcttgcgttcgtgtaatt
ggccgttctgatgttgttactgacactcaaaatgagcaatccctggaacaaattcaaatg
ttggaggattcatcacgttataggagaacacaacaagaagaagtaactgttcaacaagct
ccacaattcactcggccacttcataacatagaaaccgttgagttgacaaatgttcatctg
gaatgccgtttgcaaccggttggagatgcttctatgcgtgtagtttggcttgtcaatgga
aagccagttaaaactggacaccgatttaggccctcttacgagttcgattatgttgcactt
gacattctgggcgtctacccagacgattcgggtgtatatacctgtcaagcatacaatcaa
cttggtgaagctataacttcgtgttctgtaagagtacatgcaaagaaagacctcattctc
aaatcgcaacacccagaaggcctagagagaatacaatatctggaagatgcttcaaaatac
aagaggcatgaactcgtagatgaagtcgttaatgtcaagcctagatttataacgcatcca
aagaatcaggaaaatctcagagaaggacataacgctcattttgaatgcaaacttgagcca
gtaacagattcaaatttaaaagtcgaatggttaaagaatggacgtccaattcagatagga
catcgattccgtccaatccatgattttggttacgttgccttagaggtaataggtgtcatt
gccgaagattctggtgtatacacatgccgagctgaaaatctcgttggaagggatgaggtg
aactgtacattgaactgtcgttctactgctcaaattttaacagatacgcaaaacgagtct
ggtctagaacaaatccactaccttgaagatagatcgaaataccaacgccgagaagatgtt
gaagaaataacaactcaagctccgatattcacaacatctttgaataatgtagaaattaaa
gaagggcaacgtgcacactttgaatgcagattaattccagtatcagatgccacaatgaag
gtggaatggttccataataatttgccagttaaagcaggatcacgttttgttgaaacaaac
agttttggttttgttgcattggatattatgtatgcgtatccagaagatgcaggaacgtac
acatgtcgtgctagaaatgctataggcgaagccatcacttcggcaactgctgtagttcat
tctaaaaagtctatttatctagaaactcaaaatgaggaagccttgcaaaaagtacgtcaa
ctggaagatcattcgcgttaccaacgtaagactgtacaagaagaaacagtctcgcaagct
ccagtatttactatgcctattaaagatttacaagttgctgaaaatcaagctgcacacttc
gaagcccgagtcattccggtcggagattcaaagcttgtagtacaatggttacgtaacggt
gttccaatttcagcttctaatcgcattacaactatgcatgactttggttatgttgctctc
aatatgaagtatgttactccagaagatgcaggtacctatacatgtagagctgtcaacgat
ttaggtgaagctgtaacatctgctactctgtttgttcaatctaaagcagcattacaattc
gaatcacaacacgaaggcgcattatcaaaacttcaagccctcgaagatacaaataaatac
caaagacgtgaagaagaagatattgtagttaacgaaaaaccaagatttaccgttcaattg
aatggaccaactaacttagttgaaggtcaaagcgcacattatgagtgtcgtatagaacct
tatcccgatacgaacttgaaagttgaatggttccataacggcaaaccactttctactggt
catagatacagaacagcttatgacttcggctttgcttcccttgacgttctgtcagtttat
gctgaagattctggtacatacacttgtagagccacaaataaactcggtcaagaacaaagt
tcaataaaccttgatgtaaaatctcgagcgtcaattatccgagaaacgcagcacgaagga
gctttaaagaaaatacagtatcttgaagatgattcacgttacaaacgaacagatagagaa
gatgttattatcgctgaaaagcccaaatttggacgtccacttaagaacatagaacatttg
cctgaaggtaaaagtgctcacttggaggctacactgactccagtgaatgacccaacaatg
gtagttgagtggtacagagatggaagaccaattcctcaaggccacaaattcaaaacaacc
tatgactttggatatgttgcccttgatattatgtatgcttaccctgaagattctgggact
tacatgtgtaaagctagaaacgctgtcggtgaagctgtcaccacttgcgtcatttctgtt
gattgtaagcaaggtctatatctcgataccctggacgcacaacgtcttgaaaagattcgt
cagctagaaactgtagaggtcaagcatgttgttgagaaggaaattgtccatcaaaagcct
gtcttcctaactccactaaataatctggaccatcttaaagaaggtgaacatgcccacttg
gaatgccgtgtagaacctataaacgatgccaatttgaaaatagaatggtttgttaatggt
aaagctgtaaaaactggtcatcgtttccgcacaacgcacgactttggatatgtagctctt
gatattctatacagctatgctgaagattctggtacttatatgtgtaaagctacaaatctt
gctggcgaagctgttaatacatgcactattaaagttggatctcaccgaagccttatactt
gatactcagcatcctgatggtttagaaaaaataagagaattagaagcacaaggtcgacca
gctagattggaagttgaagaacccccagtgttccctccgaaatttgtcacagaacttaga
ggaacaacggagatctatgaaggacaaacagcacatttcgaatgccagattgaaccatta
catgatgccaatttacgaattgagttcttccacaatggtaaaccactaccatctgcatct
agattccatgtcactttcgattttggttacgttgcacttgatataagccatgcagtacca
gaagatgctggacaatattctgtgcgagcaattaacgctcttggacaatgcgtctcatcg
atcgagctcaaagttataccaaaagataatattattttggaatcgcagagaccagaagga
ttagataagatacgtgagctcgaatccctgcaaccatggaagagaccagatgttcctgag
cctcaaacaagacaacgaccagtctttacgcagcctcttcagaatattgatgctattgct
gaaggacaaacagctcactttgaatgcagattaattcctgttggagatccgacactcaaa
gttgaatggtttagaaatgagaagccgcttgaaacaagttctagaatcaccaaagttcac
gattttggttacgtttctcttgatattacccatgttcgcgaagaagatgaaggtgtttac
atgtgtcgggcctctaatcctttgggtgaagctgttactactgcttctatgaaaatccaa
tcgaaagcaaatattcaactagatacacaacaccctgagagtcaacgaaaaatagctcgt
ttagaagctgacaaagtaccaacacgcgcagaagagcctgaaaaagttttcgataagcct
atctttacgcaattgctgactggcccaaccgaattatgggaagggcaaattgctcgatat
gaatgtcgggtagtaccagtcggtgatgctagtcttagattcgagtggtatgtcaatggc
gttgaactaaaaatgggctctcggtatcacgttaatcacgactttggattcgtcactctg
gacataatgaaggtcattcctgaagattctggtgtatatacttgtaaagctatcaataat
gcaggtgaggctgtatcttcgatctcattaaaagtaaaggcaagatctgctatatctggc
gatgctattcaacctgatgcatggaaaaagatacagctgaaagaagcagaaatgaacaaa
gttccggaaatgtttgttgatactacgccgcaacaagcacctgttttcactactcactta
aagagctatgacaagttagttgaaggccaacatgtttacttggaagcacaagtagaaccc
cgtgctgatccaaatcttcgcgtcgaatggttcaagaatagcgttcctttacaaatagga
acacggctgaagagcactttcgattttggattagtttcactatcaataaatggacttcgt
ccagatgattctgcaatttatacttgcaaagccactaacttacttggggaagctgtatca
actagtagtctgaagatcgcagatcgacactggcttttaggtgatactctacatccagat
gctctttctaaaattagtgctcttgaacaacctccagaaggtaccaaagaacagccggaa
ccaacgtatgaagaacctgtgtttattagtcatttgaataatgtagaatgtactgaaggt
gataatgttcactttgaatgcaatgttgagccatctaaagatccaacaatgaaaatagaa
tggttccttaatggaaaacctttgccatatggtgcaagatataaatcaacttatgacttt
ggctacgtagctttagatttgaatcatgcttacgaggaagactctggcgttataaccgta
aaagcaacgaattccaagggttctgctcaaacatctggtaccttaaaatgtactagtaag
cagagtatttatttgcaaacacagcatccacaagggcaagcaggtttagaaaaagtcaag
gaagtagatgatgcatatgcttcgaaggccaagagatcagacagtggaccagaaaaagaa
tatcctaaacctatttggacagttccacttcaacctgaattcaaactgggagaagctgag
ccactacatttggaaggacaagtagaaccgaaagatgatccaaatctcaagatcgaatgg
tacttcaatggcaaaatattgcagcatggagcaagattcaaaatgacatgtgatttcggc
tttgtaactttagatttgactgatgtttatgacagagattctggaatttacacatgtaaa
gcatacaacaaagccggtgaagcgttcacttcatcaactatttattgctcgaccaaagaa
aatgtcattgaacgctctcaacatccaaaaggaaaagaaggtcttgaagctattcaagat
ttagaagaatctttgagaaaacaaccaggtgctgctccagaaagtgagggcggacacgca
ccatctttcacttcccaatccgataacctttcgaatttgtctgagggagaactcgctcat
ttcgaagcaactcttattccaactggagatcaaacaatggtcgttgaatggttcttcaat
gaaaatcagattgaagcaagtcatcgtattcgtactgtttatgcatttggaacagttgtt
cttgaagttcttggcacgaagatagaagattccggaacttatacctgtagagcaactaat
aaatggggcaaagccgaaattagcttgactttggagtgtattgacaaatcaatgggtcaa
aaaccaagattcacgacccaaattcaatctttggaaggtcttaaagataatcaatctgct
cactttcaatgcactttaatacctgtcggagatccaaacatgaaagtcgaatggttccac
aacggacaaccattgcgtcattcatcacgtttcaagatggtatcagactttggattcgta
gtcatggatattgcaggtgttatgtcgcatgattctggtgaatacgtatgcaaagcaagt
aataaatacggtgaagactatacaaaagctacgattaagtgcttcggtaaaagcggcgtt
tatcttgattcactacaaccggattctttagcaaaaattagagaattagaggcattcacc
ggggaacaatatgcagcgccagtagctccagtggctgaacctcctaaattcattacgcaa
ataactgacatcacgaaattagtagaaggtcaatcagctcacttcgaagctaggttaaca
cctgtaacagatcctgatttgaaaatcgagtggtattacaacggcaaaaaattgcctcaa
ggtcaccgataccgcacgttccacgattttggaattgttattcttgatatactgtattgt
tatgaggaaaattctggtgaatacgaatgcagagcagttaataaatatggtcaagactct
acaaaagcaaccttacgttgtttgtcaaaggctaatttgatattggagtcacagttgcct
aaaggtatggaaggaggcttggaaaaaatacaaacactggaagatgctatgattaagacc
cgtgaggaaaaggttacagaaactaagggcaaagctccagtatttactgttccacttagc
aacttagatggcctacgtgaaggagaaagcgcccactttgaagctcgtttaacaccaact
gatgatccgaaattaaaggtggaatggttctggaatggcaaaccattaagaactggtact
cgattccgaacattctgcgattttggatttgtgattcttgaaatatcgcctatttatcca
gaagattctggggaatatagttgccgagcaactaatgattacggtgaggcagtaacaaca
tgctccatgaaatgtacaggaaagcgtagtattattttagaatcacagttgcctaaagga
atggagggaacaattgataagatcgctgaattagaaggacttggtgcagaacctggtcaa
cctagtcccgatgacgacacgggaaaaccaccagaattcattactactccatcagatttg
acgctttctgaaaattctcttgctcatttcgaatgcagattacaacctgttaacgattct
agcatgagagtcgaatggttccacaatggtaaacctttgttagctggatcaagagttaaa
accatctatgatttcggttttgtaattcttgaagttgcaaactgctaccaacgggattcc
ggcctatatacttgtaaagcagttaatagacacggagaagcaactgttaattgcaaactt
caagttcgaggtaggcaaggaattattcttgaacctcagcttccaaataactttaaaact
ggaacggaaagcattcaaaagcttgaagaatcactttataaaaaagatgagatcttaccc
gaagaagaaaaacccagtccaccaagattcatagttgaattgaaaaacatagaagttaac
gaaagtgaatcaagtcatttcgattgccgagttgagcctacaggagactcgacaatgcga
atcgattggtaccataatggaagaccatttgctactggatctagagtacatcaaattaat
gactttggattcatttcattagatctatcatatacttatgcaagagatagcggtgaatac
gtttgcagagctacgaataaatggggttcagctatcacaaaggctactattacttgtaca
tctaaaaaatctattgattttgattctcaactgccatctggcatgagtggagaaaaattg
aaagaattagaacgtgggccagtatcagtagcaccaccacctgaagctccccgtcaacca
ccaagatttattacccagatcaaatcttttactgtcgatgaaaatgaaccagtaagattt
gaatgccaagtcgaaccgaaagacgatcctaatctgcgcatagaatggtacagaaatgga
aaacttataccagcaggtcacagataccggactgtatatgacatgggatttgtgtcgatg
gatattttgtacgtttatccggaagactctggagaatacgtttgcaaagctatcaatgat
cttggagaagacacaacccgtgcctctgtctcttgcaaacagcaaccaagtatcatccta
caaaatcaagtaccaaaaggtatgaagaaatcggaaactctgatgcaaatggaagctact
attaagaaatacacttcagaagtacatctcacggaggacgatttgtatgatgctgagaaa
aaacagcctccaagatttgtgacacaaatcacagatcaagtggatctcgttgaaatgaac
agtaccaaatttgagtgtcaattagctccagtgggtgatcctaacatgagagttgaatgg
ttcttaaatggcaaaccactgctgcacaaaaatagattcaatacaatatacgattttgga
tatgttgcactaagctttggatgggtatatccagaagatagtggagaatacgtgtgcaga
gcaactaatttatatggcatggatgagactaaagcaattattagaacagcaggaaaacca
ggtattatttatgactctcaactaccaaaaggaatgaagagcattgaaaagattcgtgag
atggaagctgcgtggcaagttgtccctgaggaggaaaccgaagtggagaaagttcgatca
ccacctaccttcgttagtaaaccagaacctttcacagttgaggaaggagactggtccaga
ttctgttgccgagttactggtcaccccagacctcgtgttatgtggttaattaatggtcat
acagtagtaagcggctctcggtataaattgacttatgatggtatgtatcatttggacata
cctaaaaccagacagtacgacaatggaaaagttgaggttattgcaagaagttcagttggt
gaagcacgaacggaaaccacgctcaccgtcaaaccccgtagtgatgattatcgtggggtt
ctaaaaacatcacctaagccatggtatgactatgaactaacgcaatatcaggcagaaagg
caagagaccgaattagagcgcgtgttcgatgaaagaacacatagcctttcgcaaggtact
aatatagcaacggagcatcttggccaaaaagtaattaaagaaccagaaacagaatggcag
aagtctattaaatcaaagaaaaatgaagattactatactaaattaatgagtcttgaagaa
gagcaaatactcaaagaatcaaggttaagagaatcatcccatcaatttgcaattccagga
gataaaattgtgaacaattctatcgctaaaggaatggctcaaaagtaccacgaaaatcta
gaaacacagcctcaagagcctgctcaaccacctcctaaaatcagtaaaaaattcacaact
caagtagatattgattctcagcaacacaaagggccgaaatatccacctgaaccatcggaa
tccactgttcatggacgtgaagttcatgtggccaaacaaaagcaaactcagaaagaagtt
aaggatgacgtggaaataacaagaaaaataacggccactgagacaacagaagttgagcac
aaagccaagactcaagaacgtgttgttcaaggacaagtcaagccctcgaaaccacctgta
ttcactaaaaaaattcaaccatgtcgtgctttcgaacaagagcaggctaaatttgaagtt
gaatttgatggcgatcctttacccacaatcaaatggtatcgcgaagattttcctatcata
aactcagcagatctgcaaatttacacttttagtacaaaatctatattggtgatacgacaa
gtctttatggaagattcaggagtgttttcggttattgctgaaaatagaggtggaaaagca
aaatgcagtgctaatcttgttgttgaagaaagacgaagacagccaggcaggggaggaatt
atacctccaagtttcattactactgtacaaagcaccacggtaaccagtggccagttggca
agattcgatgcaaaagttactggtactaagccaattgatgtatactggttaaagaatgga
aagaaaatcagtcctgatattcgctacaaaactcttgaagaagataatatctatactctt
ttgatcttggagagtgtcgtcgaagatacaggaaaatatgaatgtgttgccataaatagt
gctggtgaggcccgttgcgaagccgagtgtattgtgcgccagcctcagcaaccaacaaaa
actgctaagccatcgcctagtgacatagaaaaagtcccaacagtattacaaccattaaga
gatcaaactattaaagaaggaacatccgttgccttctcctgcagaataagtggcaaacca
ataccaactattcaatggaaaaaagcagataagattatcaaaccatccaagtacttccag
atgcaaaaagaagtggacctttgcacgttaaggatttcagaagcattcccagaagatgaa
ggtgtatacaaatgtatcgctaaaaactccgctggagaagtaactacatcggccaatctt
aaagtacttgctcctgaccagactgatgtattaccaaagctgactccattaaaggatcaa
atcgttttagaagggcaacctgcccaatttaaaacccaagtatcccctgccaaaccgaaa
ccgactattcagtggtatcgcgaaggagcccttattcctgaatcgccggatttccagatg
attcacgaaggcaataatgctgtgcttcttatcgcgaccacttacgaagaggatacgggt
acatttacgtgccgtgcaacaacttcagcaggaactgtagaatcatcggcaaaactcatc
gttaaaactcaggagaggagatttttcgcccacgctcattattggaacccagtgaaaatt
caaccttga

DBGET integrated database retrieval system