KEGG   Nasonia vitripennis (jewel wasp): 100118363
Entry
100118363         CDS       T01081                                 
Symbol
CYP6AQ8
Name
(RefSeq) cytochrome P450 6AQ8
  KO
K14999  cytochrome P450 family 6 [EC:1.14.-.-]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nvi00199]
    100118363 (CYP6AQ8)
Enzymes [BR:nvi01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     100118363 (CYP6AQ8)
Cytochrome P450 [BR:nvi00199]
 Cytochrome P450, animal type
  CYP6 family
   100118363 (CYP6AQ8)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100118363
NCBI-ProteinID: NP_001165997
NASONIABASE: NV15253
UniProt: A0A7M6UGE1
Position
2
AA seq 512 aa
MALLTHHWGLDGLILLSSLLVGIYLYFTRNFKYWQKRGIKQVPPTALFGNIGAPLLGQKP
FIKLLSDMYKAGEDEPYIGYYVLDKPFLLLRDPELIKYVLIKDFNNFPNRVAASRKTDVV
GSMNLFVVNNPEWKYIRQKLSPIFTSGRLKKMFDLILEVDKDLDVHMNSLKLEGSGRDIE
VKDICSKFTTDIIGLTAYGMKFNSLTDPDAMIRKVGKDIFGRSYRRYLEFFAVLQVPTLV
NVFGFEVFGKAATKFLRYIFWNAINERIQSGAKRADLIDLLVGLKKEQESDSNQNSFKLE
GDTLVAQAAVFFTGGFETSSSTMSFGLYELAKNPTIQDKLRKEIRDTLDANNKKVTYDMI
MSSLPYLDMVISEVLRMYPILPYLDRNTEADYQLPGTKLVLKAGTPVVIPMQAMHMDSRY
FPKPEIFDPERFSPENKKNILPNTYFPFGDGPRICIGMRLGLMQTKLGLIHLISKYEFSP
CKDTLIPMEFDKYSVFTTSRNDIILNVRKLRD
NT seq 1539 nt   +upstreamnt  +downstreamnt
atggccttgttaacgcatcactggggcctcgatggcctgatacttctgtcctcattactc
gtcggtatttacttgtatttcacgagaaatttcaaatactggcaaaaacgaggaataaaa
caggtaccaccaacggccttgttcggtaatatcggtgctccccttctgggtcagaaaccg
tttatcaagctcctgagtgatatgtacaaggccggagaagacgagccttacatcggttac
tacgtactggacaagccttttctgctactccgcgatcctgaactgattaagtacgtcctg
atcaaggatttcaacaacttccccaatagagtagccgcatcgaggaaaacagatgtcgtc
ggatcgatgaatcttttcgtggtaaacaatccggagtggaagtacatcaggcagaaactg
tcgccgatatttacatctgggaggctcaagaaaatgttcgacttgatactggaagtcgac
aaggatttggacgtccatatgaattcgctgaagttggagggaagcggcagggacattgaa
gtcaaagacatctgctccaaattcacgacagacatcattgggttgactgcttatggaatg
aagttcaattccttgacagatcccgatgccatgatacgcaaggtagggaaagacatattc
ggcagaagttatcgaagatatctcgaattcttcgccgtactacaagttccaactctagtc
aatgtcttcggtttcgaagttttcggaaaagccgcgacaaagtttctcaggtatattttt
tggaacgctattaacgaaagaatacagagtggcgccaaacgagcggacttgatcgattta
ttagttggattgaaaaaggaacaggagtctgattcgaaccagaattcgtttaaattagaa
ggcgacactttggtagcccaagctgcagtattcttcactggtggatttgaaacttcttcg
tcgaccatgtcgtttggcttatacgagttagctaaaaaccctactatacaagataagttg
cgaaaggaaatccgagacactttggacgcgaataacaaaaaagtaacttacgacatgata
atgtcctcactgccgtacttggatatggtaatcagtgaagttttgagaatgtatccaatt
ctgccgtacttggatagaaacactgaagccgactaccaactccctggaacaaagctagtg
ttgaaggctggaactccggtggttattccaatgcaggctatgcatatggattcccgttat
ttccccaaacctgaaatttttgatccagagcgattctctccggaaaataaaaaaaatatc
ttacccaatacctatttcccgtttggtgacggaccgcgcatttgcattggaatgaggctt
ggacttatgcagacaaaacttggactcatacacttgatatccaagtacgaattttcgccc
tgcaaggatactttgattcccatggagttcgacaaatactcggtctttacgacttcgcgc
aatgacataatacttaatgtgagaaaattaagagattga

DBGET integrated database retrieval system