KEGG   Nasonia vitripennis (jewel wasp): 100118369
Entry
100118369         CDS       T01081                                 
Name
(RefSeq) decaprenyl-diphosphate synthase subunit 1 isoform X1
  KO
K12504  decaprenyl-diphosphate synthase subunit 1 [EC:2.5.1.91]
Organism
nvi  Nasonia vitripennis (jewel wasp)
Pathway
nvi00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:nvi00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    100118369
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nvi01006]
    100118369
Enzymes [BR:nvi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.91  all-trans-decaprenyl-diphosphate synthase
     100118369
Prenyltransferases [BR:nvi01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   100118369
SSDB
Motif
Pfam: polyprenyl_synt
Other DBs
NCBI-GeneID: 100118369
NCBI-ProteinID: XP_008210202
NASONIABASE: NV18793
UniProt: A0A7M7H947
Position
4
AA seq 457 aa
MRRDRRRQVNRVEWTDAYIHTSYYLDELQLMYRWKGSSRLCAARAEKLCQFRRNIASSVN
FRRELVDQPQQQHPSVQQAAPISGSIASTTGSRLFQRSQSSPRYGGRSCRTTSIARAISS
MQTQQPGSLPDYRIDPYQLLEDDLKNVYEDIRRELVANTSHEELRTIATYYFGGQGKALR
PMVAILMARAINYDKDQSGLLASQRQVAMISEMIHNASLVHDDVVDQSDFRRGKPSVNAL
WSQKKVTMAGDFILAVASMMIARLQNDDVTLTLSQVITDLVQGEFMQLGSKETENERFAH
YLTKTYRKTASLIANSAKAVAMLGGADERLAELAFQYGRNIGLAFQLVDDLLDFVSSSDA
MGKPTAADLKLGLATAPVLFACERFPELNPMIMRRFQEPGDVEKAFELVHKSQGLEQTRF
LAKKHCVEAVRLAQTLAESPYQKSLMVVSDLVINRIK
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcgcagagatcgcagaagacaagtcaatcgggtggaatggacagatgcgtacatacat
acatcatactacttagatgagttacagcttatgtataggtggaaaggctcgagtcggctc
tgcgcagcccgtgcggagaaattgtgccagttccggcgtaacatcgcctcctctgtcaac
tttcgtcgcgagctcgtcgatcagccgcagcagcagcatccatcagtgcagcaggctgcg
ccgatcagcggcagcatcgccagcaccaccggcagcagactgtttcagcgatctcagagc
tcgccgaggtacggaggacgcagctgtcgcacgacgagcatagcccgagcgataagctcg
atgcagacgcagcagccgggatcgctgccggactaccgaatcgacccctaccagctcctc
gaggatgatctcaagaacgtgtacgaggacataagaagggagttggtcgccaacacgagc
cacgaggagctgaggacgatagcgacgtactacttcggcggccagggtaaggcgctcaga
cccatggtcgcgatactcatggcgagagccatcaactacgacaaggatcagagcggtctc
ttggcctcgcagcggcaggttgcgatgatttccgagatgatccacaacgcctcgctggtg
cacgacgacgtcgtcgaccagtcggactttcgccgaggaaagccttccgtcaacgcgctc
tggagccagaagaaggtgacaatggccggggacttcattctcgctgtggcttcgatgatg
attgcgcgcctgcagaacgacgatgtcaccttaacactgagtcaggttatcaccgacttg
gtccagggcgagttcatgcagctcggctccaaggagacggagaacgagcgcttcgcccac
tatctcaccaagacctacaggaagacggccagcctcatcgccaattcggccaaagcggtt
gccatgctgggcggcgcggacgagcgactcgcggagctcgctttccaatacggaagaaac
atcggcttggcttttcaactggtcgacgatctgctcgacttcgtgtcctcctcggacgcg
atgggcaagccaacggctgccgacttgaagctgggcctcgccacggcgcccgtgctcttc
gcctgcgaaagatttcccgagctcaaccccatgataatgcgtcgcttccaagagcccggc
gacgtcgagaaggccttcgagctggtccacaagtcccagggcttggagcagacgagattt
ttggcgaaaaagcactgcgtcgaggccgtcaggctggcgcaaaccttggccgagagtccc
taccagaagagcttgatggttgtcagcgacctggtcatcaatcgcatcaagtag

DBGET integrated database retrieval system